PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10027033m
Common NameCICLE_v10027033mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 162aa    MW: 18535 Da    PI: 6.6115
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10027033mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.62.4e-396103198
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk lrrkC+kdCvlapyfp+++p++f  vhk++Gasn++k+l+++p++ re+a++s++ eA+ r++dPvyG+vg+i++lqq++ ++++el
  Ciclev10027033m   6 RCAACKSLRRKCPKDCVLAPYFPSTDPQRFSEVHKIYGASNISKMLQNIPQHLREMAADSMAIEAKLRVQDPVYGCVGIIHQLQQRIIEVQSEL 99 
                      6******************************************************************************************999 PP

           DUF260  95 allk 98 
                       + k
  Ciclev10027033m 100 LKSK 103
                      7765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6135106IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-396101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MEGSSRCAAC KSLRRKCPKD CVLAPYFPST DPQRFSEVHK IYGASNISKM LQNIPQHLRE  60
MAADSMAIEA KLRVQDPVYG CVGIIHQLQQ RIIEVQSELL KSKCEIAFCN AHELQQQQQW  120
QQLQHWQQQQ PMFHAAHELS WLDSSDQQEL TSDPSFSEFG F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3541049116LOB family transfactor Ramosa2.1
5ly0_B2e-3541049116LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024037003.11e-114LOB domain-containing protein 24
SwissprotP594681e-43LBD24_ARATH; LOB domain-containing protein 24
TrEMBLV4S0Y51e-116V4S0Y5_9ROSI; Uncharacterized protein
STRINGXP_006427748.11e-116(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-45LOB domain-containing protein 24