PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10024246m
Common NameCICLE_v10024246mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family TCP
Protein Properties Length: 384aa    MW: 43748.3 Da    PI: 7.5579
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10024246mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP136.22.8e-421402773133
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt...........ssssaseceaesssssasns 85 
                       kkdrhski T++g+RdRR+Rls+++a++fFdLqd+LG+dk+skt+eWL+ qakp+ik+l +            +++  sec    ++++   +
  Ciclev10024246m 140 SKKDRHSKINTAKGPRDRRMRLSLDVARKFFDLQDMLGYDKASKTVEWLMIQAKPEIKKLIERclpevnccgdvGAKGTSEC----EVEAIIDN 229
                      69*************************************************************4444444444433333444....23333344 PP

              TCP  86 ssgkaaksaakskksqksaasalnlakesrakarararertrekmrik 133
                      s++ ++k + k+kk ++s +  + lak+ r+karararert +km  +
  Ciclev10024246m 230 SAAIRRKISVKEKKIKHSRKIIRPLAKDLREKARARARERTCKKMWSR 277
                      4445566666999999999999**********************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.4E-38140276IPR005333Transcription factor, TCP
PROSITE profilePS5136935.139141199IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.265256273IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
SSRAYLGLPP SAIAKMLPSN NNWNNNNLVS YTDQSIFHRP FFNESNQTSK EDEPSLSFFH  60
FPYELELEDH NFFLQQQYYD LLLQHQPLTP DPDDSTLPEL LVNMVDSSNS EANGLTKDCS  120
VRNQGVISNR QMPISKRSSS KKDRHSKINT AKGPRDRRMR LSLDVARKFF DLQDMLGYDK  180
ASKTVEWLMI QAKPEIKKLI ERCLPEVNCC GDVGAKGTSE CEVEAIIDNS AAIRRKISVK  240
EKKIKHSRKI IRPLAKDLRE KARARARERT CKKMWSREFD HVSKPQADEP EKNELISLGS  300
KSSFGARDTK TQDKNHSLEV LADQVEEPSS QEQPVNLGNQ EEIVDDALVI MGKWSPSSVS  360
TYLQNIGIPQ EHQFADFQYF GKQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006440913.20.0transcription factor CYCLOIDEA
TrEMBLV4T1X80.0V4T1X8_9ROSI; Uncharacterized protein (Fragment)
STRINGXP_006440913.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72692742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.12e-21TCP domain protein 12