PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10023072m
Common NameCICLE_v10023072mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bHLH
Protein Properties Length: 92aa    MW: 10315.6 Da    PI: 9.3634
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10023072mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.82.5e-1019591454
                     HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
              HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                     d+iN+  ++L++llP++ +++s K+s   +L+++++YI+sL
  Ciclev10023072m 19 DQINDLVSKLQQLLPELRNNRSDKVSAGKVLQETCNYIRSL 59
                     79**************889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.0E-10478IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088811.769559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.0E-71959IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.57E-101977IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSSRRSRSRQ SGSSRITDDQ INDLVSKLQQ LLPELRNNRS DKVSAGKVLQ ETCNYIRSLH  60
REVDDLSERL SELLATTDTA QAAIIRSLLM Q*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476632.12e-58PREDICTED: transcription factor PRE6
RefseqXP_006439625.12e-58hypothetical protein CICLE_v10023072mg
SwissprotF4JCN93e-42PRE4_ARATH; Transcription factor PRE4
TrEMBLA0A067GBS62e-58A0A067GBS6_CITSI; Uncharacterized protein
TrEMBLV4TMG92e-58V4TMG9_9R
STRINGGLYMA04G34080.12e-43(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74500.14e-39activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1