PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10021151m
Common NameCICLE_v10021151mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family BES1
Protein Properties Length: 325aa    MW: 34657.6 Da    PI: 8.2833
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10021151mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822216.37e-6731442150
           DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                      ++ r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sa asp+ss++
  Ciclev10021151m   3 SGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPVERMDIVGGSAVASPCSSYH 96 
                      789******************************************************************************************* PP

           DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa.asllpvlsvlslvsssl 150
                              +sp++sy++sp+sssfpsp+s++ + + ++ +sl+p+l++ls++sss+
  Ciclev10021151m  97 --------PSPCASYNPSPTSSSFPSPASSSYAANPNSdNSLIPWLKNLSSASSSA 144
                      ........*******************9988776665559*********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.2E-654138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MTSGARLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKGCKPVERM DIVGGSAVAS PCSSYHPSPC ASYNPSPTSS SFPSPASSSY  120
AANPNSDNSL IPWLKNLSSA SSSASSSKLP HLYIHTGSIS APVTPPLSSP TARTPRMKSD  180
WEDQSSRPGL GGQHYSFLPS STPPSPGRQI VPDPEWFAGI RLPHGAPTSP TFSLVASNPF  240
GFKDETLAGG GSRMWTPGQS GTCSPAIAAG SDHTADVPMS EVVTDEFAFG SNATGLVKAW  300
EGERIHEECG SDDLELTLGS SRTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006442380.10.0hypothetical protein CICLE_v10021151mg
SwissprotQ9ZV881e-144BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLV4TV520.0V4TV52_9R
STRINGVIT_19s0014g00870.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-127BES1/BZR1 homolog 4