PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019249m
Common NameCICLE_v10019131mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 644aa    MW: 72114.4 Da    PI: 6.8762
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019249mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.6e-2476175197
                      EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                      f kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + ++
  Ciclev10019249m  76 FSKVLTASDTSTHGGFSVLRKHATEClppldMNQSTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFL--RGEN 167
                      88****************************9445555669************************************************..4499 PP

                      E..EEEEE CS
               B3  90 felvvkvf 97 
                      +el+v+v+
  Ciclev10019249m 168 GELHVGVR 175
                      999**996 PP

2Auxin_resp105.65.6e-35202281183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t+++F v+Y+Pr+  s+F+++++k+++a+++k++vGmR+km+fe+eds+ rr+sGtvvgv+d++p +W++SkWrsLk
  Ciclev10019249m 202 ASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPDRRFSGTVVGVEDFSP-HWKDSKWRSLK 281
                      789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-4267191IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.84E-3870205IPR015300DNA-binding pseudobarrel domain
CDDcd100175.16E-2174176No hitNo description
PROSITE profilePS5086312.15376178IPR003340B3 DNA binding domain
SMARTSM010193.2E-2176178IPR003340B3 DNA binding domain
PfamPF023622.9E-2176175IPR003340B3 DNA binding domain
PfamPF065075.9E-32202281IPR010525Auxin response factor
PfamPF023091.8E-13509620IPR033389AUX/IAA domain
SuperFamilySSF542772.16E-14526607No hitNo description
PROSITE profilePS5174526.665531612IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MEQLEASTNQ ELNQRIPLFR LPSKILCRVV NIHLMAEQET DEVYAQITLL PEPSQNEPTT  60
PDPCPADSPR PKVHSFSKVL TASDTSTHGG FSVLRKHATE CLPPLDMNQS TPTQELVAKD  120
LHGYEWRFKH IFRGQPRRHL LTTGWSTFVT SKRLVAGDTF VFLRGENGEL HVGVRCLARQ  180
QSSMPSSVIS SQSMHLGVLA TASHAVATQT MFVVYYKPRT SQFIISLNKY LEAVNNKFAV  240
GMRYKMRFEG EDSPDRRFSG TVVGVEDFSP HWKDSKWRSL KVQWDEPASI TRPDRVSPWE  300
IEPFVASATP NLVQPVLAKN KRPRLPMEVP PLDLPSAASA PWSARLAQSH NLTQLSVTAE  360
DKRIDNHVAW HHKHSDFSSN SNFMSRTQSD GEWLTSPRVK FSQQLFQEAI DDNKNISAWP  420
AHSGHSTPHP SKPNNDTLLE QVETGRKTET GTSCRLFGIE LINHATSSAP SEKVPVSSLT  480
TEGHIISTIS AAADSDGKSD IAKEFKEKKQ EQVQVSPKES QSKQSCLTSN RSRTKVQMQG  540
VAVGRALDLT TLVGYDHLID ELEEMFDIKG QLHTRTKWEI VYTDDEGDMM LVGDDPWHEF  600
CNMVKRIFIC SSQDVKKMSP GSKLPMFSIE GEDILLSSDS AEK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-151130449355Auxin response factor 1
4ldw_A1e-151130449355Auxin response factor 1
4ldv_A1e-151130449355Auxin response factor 1
4ldx_B1e-151130449355Auxin response factor 1
4ldx_A1e-151130449355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439307.10.0hypothetical protein CICLE_v10019131mg
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4TGR70.0V4TGR7_9R
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9