PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10018617m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family HB-other
Protein Properties Length: 1080aa    MW: 119897 Da    PI: 8.8743
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10018617mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.4e-0769125157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ ++e+F+ +  +s++e +e++++ g+t +qVk +F  +R++ +k
  Ciclev10018617m  69 KRPRDLLNPKAVKYMQEVFALKDAISKKESREISAQFGVTVTQVKDFFASQRTRVRK 125
                      799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.36566126IPR001356Homeobox domain
SMARTSM003895.0E-568130IPR001356Homeobox domain
CDDcd000863.24E-569125No hitNo description
PfamPF000464.5E-569125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-769133IPR009057Homeodomain-like
SuperFamilySSF466896.84E-769129IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.104.4E-6250345IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.33E-6251346IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1080 aa     Download sequence    Send to blast
MEALKENSME IEIGSSAESF QKFLDSQSEL FHSQIEKLQN VVVTQCRLTG ANPLAQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQEVFALK DAISKKESRE ISAQFGVTVT QVKDFFASQR  120
TRVRKLVRLS KEKAIKSDAR KDSHNVMVPV SSDFVIPISS DYVIPTDPVP SSSACPTSVI  180
PVNPIPLNSI GPLKVDEAPS CSGRDECQLG LDDLDKHFVE NFFSLMRKEE TFSGQVKLME  240
QILRIENSSI LYWFLTKGGV MILATWLSQA ADEEQTSVLI VILNVLCHLP LQKALPEQMS  300
AILQSVKRLR YYRASDLSNR ANVLLSKWSK MFSRSQALKK HGAKHSTDSQ NELILKQSIG  360
EIMADESWLS SSNASENSLA TLCESSESFR KSESPQSVKL LTASSDDSGR KNILGVSSSY  420
NRERRKTQFV EQPGQKSAGR SLQASRLAPV GQARPMSADD IQKAKLKAMY KRQNKYGKTS  480
FLSNGINEVK AEGLEKSTTQ ATNFPPISKV LVRPHIEEFK KSVTPEPKIS SRPEAPLDPE  540
QKKDVEMPPE EKLKIVFKEP SEEKQKIGVK EPPQEKQKME VKESSQEKWL RVQIPWQTPP  600
EVKLNTHWRV GNGENSKEVE VQKNRIHRET ETICHKIQEI PCNPKEPWDL EMDYDDTLTP  660
ELPIEQPPDA DSVEETQFPS DNVTLNNAAP SLPIPSQIAP PPQIANASAS AAEPDLELLA  720
VLLKNPELVF ALTTGQAGNL SSEDTVKLLD MIKSGGAGAG LASNVNGMRG KVEEKVEVSL  780
PSPTPSSNPG TSGWRQDVVR NPFSRGSPME SNVVLSSLEV ASTEKLHTTN VIRSGISAMN  840
VTIPQQPTSA MHPSLHQTIP ERQLHSVVPS LRQSHSISSP IVQTQAMKNL PNASPSYISN  900
VKAAPMHINA PERQPVSHPS PTLIPTSARS QPQLQPQQPH MSNPTHVASL YPSRQPMGNS  960
GPASESWQAS QRLASNSRYQ VNQNNYNGSF GGPMQRRQVL SGPPRERNGY AGNDGFESWS  1020
PDNSPTRPPE YEPRRNLQEP RMNSGWSNGP DRSRQWNTSE QREVRDHNKY GYTWRDRRH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015386303.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A067HH030.0A0A067HH03_CITSI; Uncharacterized protein
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein