PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10017006m
Common NameCICLE_v10017006mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 164aa    MW: 18131.3 Da    PI: 5.688
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10017006mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601408e-4410108199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l+ el
  Ciclev10017006m  10 PCAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVMRLQREL 103
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++++
  Ciclev10017006m 104 DATNA 108
                      99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0879110IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSYSNAP CAACKCLRRK CMPDCVFAPY FPPEEPQKFV NVHKIFGASN VSKLLNEVLP  60
HQREDAVNSL AYEAEARLKD PVYGCVGAIS VLQRQVMRLQ RELDATNADL IRYACNEMPP  120
QFGARSDTNE QNSGFYFPSQ WNNNNDGSHE GGESSSMVSL RDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-6631184119LOB family transfactor Ramosa2.1
5ly0_B4e-6631184119LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006470257.11e-116LOB domain-containing protein 25
RefseqXP_006470258.11e-116LOB domain-containing protein 25
RefseqXP_006470259.11e-116LOB domain-containing protein 25
RefseqXP_024047294.11e-116LOB domain-containing protein 25
RefseqXP_024047295.11e-116LOB domain-containing protein 25
RefseqXP_024047296.11e-116LOB domain-containing protein 25
RefseqXP_024047297.11e-116LOB domain-containing protein 25
SwissprotQ8L8Q32e-67LBD25_ARATH; LOB domain-containing protein 25
TrEMBLV4UC441e-119V4UC44_9ROSI; Uncharacterized protein
STRINGXP_006446576.11e-119(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.19e-70LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]