PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10016993m
Common NameCICLE_v10016993mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 168aa    MW: 18167.7 Da    PI: 8.3747
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10016993mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.81.2e-45131121100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lq+q++ l+++l
  Ciclev10016993m  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQNQIDVLQTQL 106
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  Ciclev10016993m 107 ALAQAE 112
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.54912113IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MKESGRKQGA PSPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQE  60
LPVHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQNQID VLQTQLALAQ AEVVHLRVRQ  120
TASLSSHGFG PASPSNSGSP SSKLVASQTK PIYDMDLAHY EESMWTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-5091147112LOB family transfactor Ramosa2.1
5ly0_B3e-5091147112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4443031e-53AM444303.2 Vitis vinifera contig VV78X107337.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006448764.11e-123LOB domain-containing protein 4
RefseqXP_006468423.11e-123LOB domain-containing protein 4
SwissprotQ9SHE94e-78LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A067GFN91e-122A0A067GFN9_CITSI; Uncharacterized protein
TrEMBLA0A2H5N0K21e-122A0A2H5N0K2_CITUN; Uncharacterized protein
TrEMBLV4W7811e-122V4W781_9ROSI; Uncharacterized protein
STRINGXP_006468423.11e-122(Citrus sinensis)
STRINGXP_006448764.11e-122(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-79LOB domain-containing protein 4