PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10016841m
Common NameCICLE_v10016841mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SBP
Protein Properties Length: 190aa    MW: 21086.6 Da    PI: 9.0365
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10016841mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.92.8e-4365141278
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      Cqv++C+adls+ak+yhrrhkvCevh+ka+vvl+ g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  Ciclev10016841m  65 CQVDKCAADLSDAKQYHRRHKVCEVHAKAQVVLMGGMRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKNAA 141
                      **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.5E-3557126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.52262139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-3964142IPR004333Transcription factor, SBP-box
PfamPF031102.7E-3365138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MDAKRKNKMV KVLKKEEATA AFVDSDDDDD GGEYDLCPQE EGDDNRNSGS KKKKGSSGGS  60
GLRSCQVDKC AADLSDAKQY HRRHKVCEVH AKAQVVLMGG MRQRFCQQCS RFHELSEFDE  120
TKRSCRRRLA GHNERRRKNA AESNGEGSSC KGTGTGTQLK DLVCGKLDDK GRIKISIQEN  180
ATCKHFQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-4355138184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447265.11e-136hypothetical protein CICLE_v10016841mg
RefseqXP_006469892.11e-136PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ9S7A95e-45SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLV4U8P31e-136V4U8P3_9R
STRINGVIT_12s0028g03350.t012e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.27e-45squamosa promoter binding protein-like 4