PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10015910m
Common NameCICLE_v10015910mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family BES1
Protein Properties Length: 328aa    MW: 35292.2 Da    PI: 7.9118
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10015910mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.42.4e-6521471150
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      ++++r+ptwkEr+nnkrRERrRRaiaakiyaGLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e ++++g sasas +ss+
  Ciclev10015910m   2 TSGTRMPTWKERDNNKRRERRRRAIAAKIYAGLRMYGNYRLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVEYMDVMGGSASASACSSY 95 
                      5899****************************************************************************************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsssl 150
                      q        +sp++sy++sp sssfpsp s+  +++a+     +sl+p+l++ls++sss+
  Ciclev10015910m  96 Q--------QSPCASYNPSPGSSSFPSPRSSHYTPHANGsadaNSLIPWLKNLSSSSSSA 147
                      *........*********************9999988768888**********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.6E-663141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTSGTRMPTW KERDNNKRRE RRRRAIAAKI YAGLRMYGNY RLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPVEYM DVMGGSASAS ACSSYQQSPC ASYNPSPGSS SFPSPRSSHY  120
TPHANGSADA NSLIPWLKNL SSSSSSASSK DPHHMYIHGG SISAPVTPPL SSPTCRTPRT  180
KNDWDEPTAV AAWAGQHYPF LPSSTPPSPG RQVLPDSGWL SGIQIPQSGP SSPTFSLVSR  240
NPFGFREEVL SGGPSRMWTP GQSGTCSPAV PAGVDNTSDV PMSDCIATEF AFGCNATGLV  300
KPWEGERIHE ECVSDDLELT LGNSKTR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.11680.0vegetative tissue
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449559.10.0hypothetical protein CICLE_v10015910mg
RefseqXP_006467593.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X2
RefseqXP_006467592.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
SwissprotQ9ZV881e-138BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLV4W9570.0V4W957_9R
TrEMBLA0A067GE960.0A0A067GE96_CITSI; Uncharacterized protein
STRINGPOPTR_0004s06100.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-113BES1/BZR1 homolog 4