PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10015354m
Common NameCICLE_v10015354mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family BBR-BPC
Protein Properties Length: 424aa    MW: 47317.8 Da    PI: 10.3535
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10015354mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind350.15e-1071324231301
        GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssia..erdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdn 79 
                      mddd+ + rn+gyyep+  +k +lglqlms+++  +rd+k+    r+ n+ +++ ++a+++rd         m++ +rd+++++        ++
  Ciclev10015354m 132 MDDDALNMRNWGYYEPS--FKGHLGLQLMSTMPmvDRDTKPflpgRDPNI-MIGANGAFHPRDcvvseasipMNY-MRDSWISQ--------RD 213
                      9***9999*******99..************9999***************.************************.9*******........78 PP

        GAGA_bind  80 kllalllvenslasalpvgvqvlsgtksidslqqlse.pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkks 171
                      k+l++l+ +         + +vl++t+ ++slq+l+  p+++ +      +       p +e++ +++e +  kkrq +   k++kakk+kk  
  Ciclev10015354m 214 KFLNMLPSNP--------TFGVLPETSGAHSLQMLQPpPNMSRDDRLaPDRVAPDRIVPKVEEPVVKTEGAPLKKRQGGGASKTPKAKKPKK-- 297
                      9*****9544........5899************66656765444331333344444555566777788888899999999*******9999.. PP

        GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgaf 265
                        +k+++ ++   +r+k  kks+d+v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt++S+yPLP+stkrrgaRiagrKmSqgaf
  Ciclev10015354m 298 --PKDNNGTAV--QRVKPAKKSMDVVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKMSQGAF 387
                      ..334444444..689****************************************************************************** PP

        GAGA_bind 266 kklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      kk+LekLaaeGy+++np+DL++hWA+HGtnkfvtir
  Ciclev10015354m 388 KKVLEKLAAEGYNFANPIDLRTHWARHGTNKFVTIR 423
                      ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062173.4E-117132423IPR010409GAGA-binding transcriptional activator
SMARTSM012268.0E-184132423IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MVERHDALTP MPTILTTKPM RNSKSIYNLS ELIHNLSYTN KFKFVFTLLL ENIKAPIYSI  60
SFKAFEFQSS KIHIFRSLSF SFFLTLSPLS FSFLGLFLSP LSSLSQSQRF LSPLSSEGQN  120
PKEPFTTPQL FMDDDALNMR NWGYYEPSFK GHLGLQLMST MPMVDRDTKP FLPGRDPNIM  180
IGANGAFHPR DCVVSEASIP MNYMRDSWIS QRDKFLNMLP SNPTFGVLPE TSGAHSLQML  240
QPPPNMSRDD RLAPDRVAPD RIVPKVEEPV VKTEGAPLKK RQGGGASKTP KAKKPKKPKD  300
NNGTAVQRVK PAKKSMDVVI NGIDMDISGI PIPVCSCTGA PQQCYRWGCG GWQSACCTTN  360
VSMYPLPMST KRRGARIAGR KMSQGAFKKV LEKLAAEGYN FANPIDLRTH WARHGTNKFV  420
TIR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.207170.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006448067.10.0hypothetical protein CICLE_v10015354mg
SwissprotQ9SKD01e-115BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLV4U5W10.0V4U5W1_9R
STRINGVIT_01s0011g06380.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-109basic pentacysteine 2