PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10014928m
Common NameCICLE_v10014928mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family HB-other
Protein Properties Length: 520aa    MW: 58664.9 Da    PI: 7.1033
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10014928mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-182175357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     kR+  t+ q+ +Le+++++++yp++e++ + A+++gLte+qV+ WF+ rR kek+
  Ciclev10014928m 21 KRRYKTPAQVMALEKFYNEHKYPTEEMKSQVAEQIGLTEKQVSGWFCHRRLKEKR 75
                     78899*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-21275IPR009057Homeodomain-like
PROSITE profilePS5007116.1151676IPR001356Homeobox domain
SuperFamilySSF466891.03E-161778IPR009057Homeodomain-like
SMARTSM003891.6E-171980IPR001356Homeobox domain
CDDcd000862.07E-162175No hitNo description
PfamPF000464.3E-162175IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MEDSSEMHSE ENKVSLEKNI KRRYKTPAQV MALEKFYNEH KYPTEEMKSQ VAEQIGLTEK  60
QVSGWFCHRR LKEKRLSVDE AFVGGRQDRS SGVIQDRGSG LRQDSCGSTK QGDYRSIEPR  120
EVQSRMLYCH DFPATDLAYD RNQYAAHASE RDDTSSESSS FLQDRLYSES DKPYANETSR  180
FVRQNGDITP VRCNIGKSKE YKPSGYLKVK GESENAAISA VKRQLGRHYR EDGPPLGVDF  240
DPLPPGAFES PSGDPVNEPF YVGNSRWSNS PDVPEIDKPR ALGTRYEVDS SKMDLQDSYI  300
DENLNSKRSD YAGTKSHNQL KQKSPLLHYS NFSPHQNSSL NAYEDSTPVY DGNHCYSLSS  360
KHDAEWMGLN SVMNHHEPHG GKTNSEEAKP LLNDNHVVSS KMVRNSNYFT RPSNFTLGIS  420
ESLDAKDKGT STKMAKVKKL YKEKKAIKGL RDPVSVKTHL NNEMNVVKRL KGELPQRDYI  480
AKASYAEIPR WTNPIKGSAA EMPSSFSEDE TAETNSSME*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446272.10.0hypothetical protein CICLE_v10014928mg
TrEMBLV4U0U50.0V4U0U5_9R
STRINGVIT_06s0009g03530.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-91HB-other family protein