PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10014039m
Common NameCICLE_v10014022mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family HB-other
Protein Properties Length: 1486aa    MW: 168255 Da    PI: 6.0008
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10014039mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-182177157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     + kR   t++qle+Le+ ++ ++yps++ r+eL+++lgL++rq ++WF+ rR k++k
  Ciclev10014039m 21 KTKRKMKTASQLEILEKTYAVESYPSEALRAELSAQLGLSDRQLQMWFCHRRLKDRK 77
                     6799***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-17577IPR009057Homeodomain-like
SuperFamilySSF466891.8E-151877IPR009057Homeodomain-like
PROSITE profilePS5007116.5361878IPR001356Homeobox domain
SMARTSM003897.4E-162082IPR001356Homeobox domain
PfamPF000462.6E-162177IPR001356Homeobox domain
CDDcd000867.12E-142177No hitNo description
SMARTSM005711.5E-22529588IPR018501DDT domain
PROSITE profilePS5082717.364529588IPR018501DDT domain
PfamPF027915.4E-17531585IPR018501DDT domain
PfamPF050661.4E-15711779IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.2E-7932971IPR028942WHIM1 domain
PfamPF156132.9E-1211131183IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1486 aa     Download sequence    Send to blast
MEAASEAEEK KKKKPLEGEV KTKRKMKTAS QLEILEKTYA VESYPSEALR AELSAQLGLS  60
DRQLQMWFCH RRLKDRKAPT AKRQPKDFQS LVPAGEKELA GSELVRGGMA VQRFYEVPMA  120
PMLPFPLPQR NIAEMRAIAF VESQLGEPLR EDGPILGVEF DSLPPDAFGR PIGPAAMGHQ  180
KHSVRPLEAK EYERLDVKPF KGATRTVHEY KFLPEQPTVR SETHEKAASS YPYGSPADGS  240
TARNSSLRAG HPFMHGSEQI SSGYGFPGQL PNLNLLSHQG RHSHLLPSVS GEYENILQKN  300
SFISAGMDAH VGGQPITAMD NAFISYDRRV SHDEDVSRTE KKRKSEEARI AREVEAHEKR  360
IRKELEKQDI LRRKREEQIR KEMERQDRER RKEEERLLRE KLREEERYLR EQRRELERRE  420
KFLQKESIRA EKRRQKEELR RVKEAERLKV ANERAVARRI AKESMALVED ERLELMELAA  480
SSKGLPTIVS LDFETLQNLD LFRDRLCTFP PKSVQLKRPF AVQPWNDSED NIGNLLMVWR  540
FLITFADVLG LWPFTLDEFV QAFHDYDPRL LGEIHVALLR SVIKDIEDAA KTPFTGLGAN  600
QNSAVNPGGA HPQIVEGAYA WGFDIRSWQL HLNALTWPEI LRQFALSAGF GPQLNKRNIE  660
KMYPHDNNEG NDGENIISNL RNGSAVGNAV AIMHEMGLSN LRRSRHRLTP GTVKFAAFHV  720
LSLEGSEGLT ILEVADKIQK SGLRDLTTSK TPEASIAAAL SRDTKLFERT APSTYCVRAA  780
YRKDPGDADA ILSAARERIR VFKRGFVDGE EADDAERDEE RDEDSDSDVP EVPDVYDMDT  840
DLNSKEETHE YLEANSCGAK TPLGNREANI KGIESPQGDL GNSGRGLSSK NSEDFDEIKG  900
TGALTDHCED ATGISNAATP DQTHTDINES HPGEPWVQGL TEGEYSDLSV DERLSALVAL  960
IGVAIEGNSV RIALEERLEA ANALKKQMWA ETQLDKRRIK EDCMLKMQYS SYMGNKAEPS  1020
LAISSADGRQ SPLVTVDDKS NGMLVDLNLQ QGQFGEPQKD QNCNTSMPPE GNQDYPVGPD  1080
NLVNQQSAYA AEKSRMQLKS YIGQKAEETY VCRSLPLGQD RRRNRYWRFI TSMSENDPGC  1140
GRIFVELCDG RWRLIDSEES FDALLASLDV RGLRESHLHS VLQMIEMSFK ETVRRNLQHV  1200
TTEVQNHETV KAEVIERASC PDYTGTDNPS SIVCDSDSEI SDTSTSFSIE LGRDDVLRND  1260
ALKRYQDYER WMWKECVNSS ILCAMEYGKK RCKQVLGVCD YCHDLYFFED SHCPSCHKTF  1320
DTSKRYLNFS EHVAQCQGKL KMNPAWSSCT SFSSPLRIRL LKVLLALFEG SVPSEALQSI  1380
WNDSYRNSWG MKLNSSLSAD SLVQILTQLE NAIKRDYLSS NFETTSLRLM ELDRSIAYLP  1440
HQRVEFQKEK REGNLMGIVF LTVFSPLNSL EASIKICCCE KHQRW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446704.10.0hypothetical protein CICLE_v10014022mg
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLV4W2060.0V4W206_9R
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator