PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10013502m
Common NameCICLE_v10013502mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 256aa    MW: 28972 Da    PI: 7.5213
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10013502mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.11.1e-36101091100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCa+Ck++rrkC+k+C la+yfpa+qpk+f+nvh+l+G+s vlk+l++++++++++ams++++e+++ra+ Pv+G++g+ ++l++ql+ + +el
  Ciclev10013502m  10 ACAVCKYQRRKCEKNCKLAKYFPANQPKTFQNVHRLYGVSSVLKILDSVEDDKKDIAMSTVIFESNMRAEYPVHGCFGLTFRLHHQLQASMEEL 103
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                       l++++
  Ciclev10013502m 104 RLVNAQ 109
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3399110IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-3410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MTIKGGTKQA CAVCKYQRRK CEKNCKLAKY FPANQPKTFQ NVHRLYGVSS VLKILDSVED  60
DKKDIAMSTV IFESNMRAEY PVHGCFGLTF RLHHQLQASM EELRLVNAQL AVCQRHYQNH  120
TQAASASTSS ELGMAMNNMD IYNQQGNEFC VETDDDVKPF IKIEQNPNYY TDMFNNMPLG  180
IQSPSSSHGI PIPLQELECI NSIHDDRVMA FDHTIPDHDR NPYLEPKAKE VSDASRISTR  240
VALHPAKCFS LIRVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2061107111LOB family transfactor Ramosa2.1
5ly0_B1e-2061107111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482664.21e-172LOB domain-containing protein 3-like
TrEMBLV4SU830.0V4SU83_9ROSI; Uncharacterized protein
STRINGXP_006431057.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.19e-41LOB domain-containing protein 27