PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10011386m
Common NameCICLE_v10011386mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 567aa    MW: 62490.1 Da    PI: 6.7421
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10011386mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.13.7e-33222279260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK+vkgse+prsY++Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Ciclev10011386m 222 EDGYNWRKYGQKQVKGSENPRSYFKCTFPDCPMKKKVERSL-DGQITEIVYKGSHNHPK 279
                      7****************************************.***************85 PP

2WRKY105.62.5e-33390448159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Ciclev10011386m 390 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTTGCPVRKHVERASHDMRAVITTYEGKHNHD 448
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.7E-28213280IPR003657WRKY domain
PROSITE profilePS5081123.009216280IPR003657WRKY domain
SuperFamilySSF1182909.94E-25217280IPR003657WRKY domain
SMARTSM007742.7E-36221279IPR003657WRKY domain
PfamPF031065.4E-25222278IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-37375450IPR003657WRKY domain
SuperFamilySSF1182902.75E-29382450IPR003657WRKY domain
PROSITE profilePS5081138.595385450IPR003657WRKY domain
SMARTSM007745.5E-39390449IPR003657WRKY domain
PfamPF031061.0E-25391448IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MASSSFFMNN SMDSFSQNRT TTTANTTSSS STITSSWGFT NYTNSDHQIG LEIPKFKSLS  60
PSSLPLSPPP VSPSSFLSIP PSGFSPGALL DSPVLFSNIL ASPTTEAFNW ISNQQNISKM  120
EENNYFDFSF QTQTRPSSNS VSVQEESVKR QQEPWNFNKP TKESDFSTEN PGVKSEFAPM  180
ESFSSDMASY QTNVQSNAAP QSGNYGHYNQ SSAYTREQKR SEDGYNWRKY GQKQVKGSEN  240
PRSYFKCTFP DCPMKKKVER SLDGQITEIV YKGSHNHPKP TSTRRSSSSQ SMQHSTCANS  300
DLSDQSVGPL GNTHTDSFSM QNESSTSFGE DDFVEQGSPT SNPIGDDDEN EPDAKRWKGE  360
NDIEGVIGTG SRTVREPRIV VQTTSDIDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTTTG  420
CPVRKHVERA SHDMRAVITT YEGKHNHDVP AARGSGYTLT RPLPNTNTGN VPVPIRPSVT  480
AMASHSNLSN YSNSLNNTRF PSSSGSQAPY TAAMLQSTGS YGISGFAKPT GSYMMNQTQQ  540
SDGLFNRAKD EPRDDLFLES FLNSNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37215451878Probable WRKY transcription factor 4
2lex_A2e-37215451878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in roots, leaves and flowers, and at lower levels in stems, siliques and seeds. {ECO:0000269|PubMed:18839316}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Involved in defense responses. Required for resistance to the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21990940). Regulates the antagonistic relationship between defense pathways mediating responses to the bacterial pathogen P. syringae and the necrotrophic pathogen B.cinerea (PubMed:17059405). Required for the phytoalexin camalexin synthesis following infection with B.cinerea. Acts as positive regulator of the camalexin biosynthetic genes PAD3 (CYP71B15) and CYP71A13 by binding to their promoters (PubMed:21498677, PubMed:22392279). Acts downstream of MPK3 and MPK6 in reprogramming the expression of camalexin biosynthetic genes, which drives the metabolic flow to camalexin production (PubMed:21498677). Functions with WRKY25 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Functions with WRKY25 and WRKY26 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). The DNA-binding activity of WRKY33 is increased by SIB1 and SIB2 (PubMed:21990940). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21336597, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940, ECO:0000269|PubMed:22392279}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress (PubMed:18839316). Induced by infection with the necrotrophic fungal pathogen B.cinerea (PubMed:17059405, PubMed:21498677, PubMed:21990940). Induced by infection with the bacterial pathogen P.syringae pv. tomato DC3000 (PubMed:17059405). {ECO:0000269|PubMed:17059405, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:21498677, ECO:0000269|PubMed:21990940}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429505.10.0probable WRKY transcription factor 33 isoform X1
RefseqXP_006481125.10.0probable WRKY transcription factor 33 isoform X1
SwissprotQ8S8P51e-128WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A2H5MWH90.0A0A2H5MWH9_CITUN; Uncharacterized protein
TrEMBLV4SUS10.0V4SUS1_9ROSI; Uncharacterized protein
STRINGXP_006481125.10.0(Citrus sinensis)
STRINGXP_006429505.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-110WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]
  2. Brand LH, et al.
    Screening for protein-DNA interactions by automatable DNA-protein interaction ELISA.
    PLoS ONE, 2013. 8(10): p. e75177
    [PMID:24146751]
  3. Ali MA,Wieczorek K,Kreil DP,Bohlmann H
    The beet cyst nematode Heterodera schachtii modulates the expression of WRKY transcription factors in syncytia to favour its development in Arabidopsis roots.
    PLoS ONE, 2014. 9(7): p. e102360
    [PMID:25033038]
  4. Divi UK,Rahman T,Krishna P
    Gene expression and functional analyses in brassinosteroid-mediated stress tolerance.
    Plant Biotechnol. J., 2016. 14(1): p. 419-32
    [PMID:25973891]
  5. Peskan-Berghöfer T, et al.
    Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots.
    New Phytol., 2015. 208(3): p. 873-86
    [PMID:26075497]
  6. Wang C, et al.
    The Arabidopsis Mediator Complex Subunit16 Is a Key Component of Basal Resistance against the Necrotrophic Fungal Pathogen Sclerotinia sclerotiorum.
    Plant Physiol., 2015. 169(1): p. 856-72
    [PMID:26143252]
  7. Wang C, et al.
    Arabidopsis Elongator subunit 2 positively contributes to resistance to the necrotrophic fungal pathogens Botrytis cinerea and Alternaria brassicicola.
    Plant J., 2015. 83(6): p. 1019-33
    [PMID:26216741]
  8. Datta R, et al.
    Glutathione Regulates 1-Aminocyclopropane-1-Carboxylate Synthase Transcription via WRKY33 and 1-Aminocyclopropane-1-Carboxylate Oxidase by Modulating Messenger RNA Stability to Induce Ethylene Synthesis during Stress.
    Plant Physiol., 2015. 169(4): p. 2963-81
    [PMID:26463088]
  9. Daumann M,Fischer M,Niopek-Witz S,Girke C,Möhlmann T
    Apoplastic Nucleoside Accumulation in Arabidopsis Leads to Reduced Photosynthetic Performance and Increased Susceptibility Against Botrytis cinerea.
    Front Plant Sci, 2015. 6: p. 1158
    [PMID:26779190]
  10. Liu S,Bartnikas LM,Volko SM,Ausubel FM,Tang D
    Mutation of the Glucosinolate Biosynthesis Enzyme Cytochrome P450 83A1 Monooxygenase Increases Camalexin Accumulation and Powdery Mildew Resistance.
    Front Plant Sci, 2016. 7: p. 227
    [PMID:26973671]
  11. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  12. Liao CJ,Lai Z,Lee S,Yun DJ,Mengiste T
    Arabidopsis HOOKLESS1 Regulates Responses to Pathogens and Abscisic Acid through Interaction with MED18 and Acetylation of WRKY33 and ABI5 Chromatin.
    Plant Cell, 2016. 28(7): p. 1662-81
    [PMID:27317674]
  13. Birkenbihl RP,Kracher B,Roccaro M,Somssich IE
    Induced Genome-Wide Binding of Three Arabidopsis WRKY Transcription Factors during Early MAMP-Triggered Immunity.
    Plant Cell, 2017. 29(1): p. 20-38
    [PMID:28011690]
  14. Nguyen CC, et al.
    Overexpression of oligouridylate binding protein 1b results in ABA hypersensitivity.
    Plant Signal Behav, 2017. 12(2): p. e1282591
    [PMID:28112571]
  15. Liu S,Ziegler J,Zeier J,Birkenbihl RP,Somssich IE
    Botrytis cinerea B05.10 promotes disease development in Arabidopsis by suppressing WRKY33-mediated host immunity.
    Plant Cell Environ., 2017. 40(10): p. 2189-2206
    [PMID:28708934]
  16. D'Ambrosio JM, et al.
    Phospholipase C2 Affects MAMP-Triggered Immunity by Modulating ROS Production.
    Plant Physiol., 2017. 175(2): p. 970-981
    [PMID:28827453]
  17. Liu F, et al.
    Interactions of WRKY15 and WRKY33 transcription factors and their roles in the resistance of oilseed rape to Sclerotinia infection.
    Plant Biotechnol. J., 2018. 16(4): p. 911-925
    [PMID:28929638]
  18. Crespo-Salvador Ó,Escamilla-Aguilar M,López-Cruz J,López-Rodas G,González-Bosch C
    Determination of histone epigenetic marks in Arabidopsis and tomato genes in the early response to Botrytis cinerea.
    Plant Cell Rep., 2018. 37(1): p. 153-166
    [PMID:29119291]