PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10010373m
Common NameCICLE_v10010373mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 147aa    MW: 16608.7 Da    PI: 8.2263
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10010373mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31.1e-3711011101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCa+Ck++r+kC++ C lap fpa++ ++f+n+hklFG+sn++k+++++++++r++a++s++ e+++r +dPv+G++gv+++l++q+e  ++el
  Ciclev10010373m   1 ACASCKHQRKKCEETCELAPFFPASRYREFQNAHKLFGVSNIQKIINSVDPSQRKEAAESILIEGNIRSNDPVHGCLGVVRNLKSQIEYYEKEL 94 
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                       +++++l
  Ciclev10010373m  95 GAVNQQL 101
                      9999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.1E-35198IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089125.2461101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
ACASCKHQRK KCEETCELAP FFPASRYREF QNAHKLFGVS NIQKIINSVD PSQRKEAAES  60
ILIEGNIRSN DPVHGCLGVV RNLKSQIEYY EKELGAVNQQ LPFFRDKEKQ HQHHAAPRAS  120
RKQPLEFGSD EEEESVDVSS LKGKKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-26210112111LOB family transfactor Ramosa2.1
5ly0_B5e-26210112111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006475549.11e-79LOB domain-containing protein 22-like
SwissprotQ9LRW15e-40LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A2H5PIN11e-103A0A2H5PIN1_CITUN; Uncharacterized protein
STRINGXP_006451481.11e-104(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-42LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]