PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10009879m
Common NameCICLE_v10009879mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SBP
Protein Properties Length: 131aa    MW: 14726.4 Da    PI: 8.4987
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10009879mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.53.4e-4238115178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +C ve+C +dl++a++yhrrhkvCe+hskapvv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++a
  Ciclev10009879m  38 CCMVEKCGTDLTDARRYHRRHKVCETHSKAPVVIVAGLRQRFCQQCSRFHELYEFDETKRSCRRRLAGHNERRRKSTA 115
                      6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375754.5E-561125IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.4E-3433100IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.31736113IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3937117IPR004333Transcription factor, SBP-box
PfamPF031101.8E-3239112IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MDNDMEEEEG GVDCYADDER KKKATGRRAA PAGTSSPCCM VEKCGTDLTD ARRYHRRHKV  60
CETHSKAPVV IVAGLRQRFC QQCSRFHELY EFDETKRSCR RRLAGHNERR RKSTAETTGE  120
GSSCRGVGPQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-34391121184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464784.17e-92PREDICTED: squamosa promoter-binding-like protein 13
RefseqXP_006451806.17e-92hypothetical protein CICLE_v10009879mg
SwissprotQ387407e-43SBP2_ANTMA; Squamosa promoter-binding protein 2
SwissprotQ6Z4619e-43SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A067FH628e-92A0A067FH62_CITSI; Uncharacterized protein
TrEMBLV4URD28e-92V4URD2_9R
STRINGPOPTR_0001s40870.15e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-42squamosa promoter binding protein-like 4