PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10007795m
Common NameCICLE_v10007795mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 602aa    MW: 64240 Da    PI: 8.2799
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10007795mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14111150242
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ e+
  Ciclev10007795m 111 KQKQCNCKHSRCLKLYCECFASGIYCDG-CNCVNCHNNVEN 150
                      89**************************.********9875 PP

2TCR51.22.5e-16195234140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Ciclev10007795m 195 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCMDCKNFE 234
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-17110150IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.712111235IPR005172CRC domain
PfamPF036381.2E-11112147IPR005172CRC domain
SMARTSM011141.0E-19195236IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12198233IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MGEGEGGEFP PKKSQSESGG DIPAKKLARQ LDFTGGFVGS VILPEHPQSQ AVTANSHPPP  60
QPQPKPVVPP VPPPPPLPGQ ATQPPVRVPK PESPKSRSRS NVEVKENTPK KQKQCNCKHS  120
RCLKLYCECF ASGIYCDGCN CVNCHNNVEN EAARREAVEA TLERNPNAFR PKIASSPHGT  180
RDNKEETGEV LMLGKHNKGC HCKKSGCLKK YCECFQANIL CSENCRCMDC KNFEGSEERQ  240
ALFHGDHANN MAYIQQAANA AITGAIGSSG YASPPVSKKR KGQELFFGST AKDPSIHRLG  300
HFQQGNHIRT SPSSTLSSIP VARASSTAAV GSSKFTYRSL LADIIQPQDL KELCSVLVVL  360
SSEAAKSVAV QRNTTEKQAE DRAGTSVASS AQGRLQSHKE PDVDRTVTDD CSSANQADKV  420
GPDDSGSDGS DGQKARPMSP GTLALMCDEQ DTIFMAASSP NRLTGHGCNT SSQLPYGQGM  480
TEVYAEQERI VLTKFRDCLN RLITFGEIKE TKYSSLARTE VGSQKDALSN GTASSRTGTG  540
NQPATVSNGV SKAYGPSALA APAAKMSQMV TATVPISNND LRHNPALPGE GDVKLKTENK  600
M*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142824e-99AC214282.1 Populus trichocarpa clone POP018-K04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451190.10.0hypothetical protein CICLE_v10007795mg
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4UJK80.0V4UJK8_9R
STRINGVIT_11s0016g03680.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-175Tesmin/TSO1-like CXC domain-containing protein