PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10007737m
Common NameCICLE_v10007737mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 634aa    MW: 68879.4 Da    PI: 8.5791
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10007737mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.47.6e-15152191242
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      ++k+CnC++s+Clk+YCeCfaag +C+  C+C +C+N+ e+
  Ciclev10007737m 152 KQKQCNCRNSRCLKLYCECFAAGIYCDG-CNCVNCHNNVEH 191
                      89**************************.********9876 PP

2TCR50.93.2e-16236275140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Ciclev10007737m 236 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCLDCKNFE 275
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.8E-19151191IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.216152276IPR005172CRC domain
PfamPF036381.1E-11153188IPR005172CRC domain
SMARTSM011141.8E-19236277IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-12239274IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MEQGETISDF APKKLARQLD FTICRASANG LLPEQSVKSQ SSQPQSHSPL QPQPPKSQPQ  60
VQSKVATPSQ SQPLVRLQLL PPSSQPHVQA HMRSPSQAMP QWQARPQHVR MVNRVPHPVH  120
KLPLPTLPPG KQESPRSRPR ANTDGKDGTP KKQKQCNCRN SRCLKLYCEC FAAGIYCDGC  180
NCVNCHNNVE HEVARQEAVG ATLERNPNAF RPKIASSPHG AQDAREDARE AQLAAKHNKG  240
CHCKKSGCLK KYCECFQANI LCSENCRCLD CKNFEGSEER RALFHGDHNG IAFMQRAANA  300
AIIGAVGSSG YGTLMTSNKR KSEELLFGVA TKDQSVIRNP QSQQGNNVQN SAVPCSQSVP  360
VSRTANASVL GSTKSALRSP LADILQPQDM KELCSLLVMV SSEATKTLTE KVGAMQTERE  420
GSRSSVASPI QEGEDSRKGH EVRNGIPDDR QSGNQMDVDG TSGSGSDGGD MLNERPLSPG  480
TRALMCDEED SAFMQAGPQT GLASKSTVQK SNAYASTRIY AEQERLILTR FRDFLNRLIT  540
CGSIKETMCS PLVKSETRSQ QKAVEDGTSR SGTEVRGYME PCGYDSAKSA VSVTLEPSCT  600
TTTVASRQNN DLPMKVGLSN GQRVVDSEIR NRN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006450654.10.0hypothetical protein CICLE_v10007737mg
TrEMBLV4WBX00.0V4WBX0_9R
STRINGVIT_11s0016g03680.t011e-176(Vitis vinifera)
STRINGGLYMA07G09380.21e-176(Glycine max)
STRINGVIT_04s0008g03670.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-134Tesmin/TSO1-like CXC domain-containing protein