PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10007587m
Common NameCICLE_v10007587mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family HB-PHD
Protein Properties Length: 727aa    MW: 81803.7 Da    PI: 9.6939
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10007587mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.43.2e-10504549853
                      -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox   8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                       ++ +e L ++F++n  ps+  +e L+k+l+L+ ++V  WF+N R+
  Ciclev10007587m 504 PPNAVEKLRQVFAENELPSRIVKENLSKELSLEPEKVNKWFKNARY 549
                      578899**************************************97 PP

2PHD32.22.4e-11240292151
                      SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSSTBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpegewlCeeCkek 51 
                      +C+ C+   +  ++++vlCd +C+ +fH+kCl+++l++e+++ + w+C+ C++k
  Ciclev10007587m 240 ICAKCKLreAFPDNDIVLCDgTCNCAFHQKCLDPPLDTESRD-QGWFCKFCECK 292
                      588888854455********56***************77775.5*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579036.64E-13231295IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.1E-10236293IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500169.971238292IPR019787Zinc finger, PHD-finger
SMARTSM002495.3E-7240290IPR001965Zinc finger, PHD-type
PfamPF006281.1E-8240292IPR019787Zinc finger, PHD-finger
CDDcd155041.22E-25241289No hitNo description
PROSITE patternPS013590241289IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.605.4E-12488548IPR009057Homeodomain-like
SuperFamilySSF466895.99E-10492553IPR009057Homeodomain-like
PROSITE profilePS5007112.066494554IPR001356Homeobox domain
SMARTSM003894.8E-8494558IPR001356Homeobox domain
CDDcd000861.01E-8497549No hitNo description
PfamPF000461.1E-7503549IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MPGDGKKVVK HSESGKSCFP KKDSGSELIA SLKFKKGSKI SKSKKLRSKS KCQSKTVNST  60
LLKRTVAESH SKGAGDDFAK SKSISQKNLH IKIDRKGSKN WASSKHKGKN SALVISKGNG  120
EVADGDGETK KLRKGRSKKR QKEKVELDEA SRLQRRTRYL LIKMKLEQNL IDAYSGEGWK  180
GHSREKIRPE KELQRAKKQI LKCKIGIRDA IRQLDSLSSV GCIEGSVIAT DGSVHHEHII  240
CAKCKLREAF PDNDIVLCDG TCNCAFHQKC LDPPLDTESR DQGWFCKFCE CKMEIIESMN  300
AHIGTSFSVN SNWQDIFKEE AAFPDGCSAL LNQEEEWPSD DSEDDDYNPE RRENSCSISR  360
AGTDDDPSSS TSLSWFSDSE TFSESMRWEM ESNGYKNYSV DSSIGSDETS DGEIICGRRQ  420
RRTVDYKKLY DEMFGKDASA FEQLSEDEDW GPAKRRRKEK ESDAVNSLMT LYGSEEKCSK  480
VKTAEVKKKL PSNAKIRRSF HRMPPNAVEK LRQVFAENEL PSRIVKENLS KELSLEPEKV  540
NKWFKNARYL ALKARKVESA QQVPGSPRIS KESSLETEKQ NADVLTFKNS LEETLVCSPK  600
SLKKIHPKKD SKSVSSGSGF EKNQQKRASL ESPVNSNQAS IELSDDVSLK KLLKAKSKKT  660
KKVKFVATGE SQAAEAEMER LCRAKGRLEC LKQTLSRFQI ENSKKSNKSH LYDMVYVPIA  720
ELREKL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1454459RRRKEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453258.10.0hypothetical protein CICLE_v10007587mg
RefseqXP_015384502.10.0PREDICTED: pathogenesis-related homeodomain protein isoform X2
SwissprotP487851e-163PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLV4U0X90.0V4U0X9_9R
STRINGVIT_11s0103g00650.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86992738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-162pathogenesis related homeodomain protein A