PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10006868m
Common NameCICLE_v10006868mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 124aa    MW: 13727.8 Da    PI: 7.7578
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10006868mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601247.8e-3961051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaC++lrr+C++dC++apyfpa++p++fa+vhk++G s+v ++l++lp e r +a+++++ eAe+r++dPvyG+v++i+ lqqq+++++++l
  Ciclev10006868m   6 RCAACRHLRRRCPSDCIFAPYFPANDPHRFACVHKIYGSSKVGNMLQDLPVELRAEAADAICIEAECRVQDPVYGCVRMISLLQQQIHNAESQL 99 
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  Ciclev10006868m 100 VKARAE 105
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3765106IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-386103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MSTSSRCAAC RHLRRRCPSD CIFAPYFPAN DPHRFACVHK IYGSSKVGNM LQDLPVELRA  60
EAADAICIEA ECRVQDPVYG CVRMISLLQQ QIHNAESQLV KARAEIAVLG SHAQELRHHG  120
QDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-3321067111LOB family transfactor Ramosa2.1
5ly0_B7e-3321067111LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006421851.18e-87LOB domain-containing protein 24
SwissprotP594685e-47LBD24_ARATH; LOB domain-containing protein 24
TrEMBLV4SDL72e-85V4SDL7_9ROSI; Uncharacterized protein
STRINGXP_006421851.13e-86(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.16e-32LOB domain-containing protein 24