PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10006694m
Common NameCICLE_v10006694mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 117aa    MW: 13411.1 Da    PI: 5.0818
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10006694mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26033.41.3e-1031646295
           DUF260 62 vyeAearardPvyGavgvilklqqqleqlkaela 95
                      yeA+ r+rdPvyG++g++ +lq+q+++l+a+ +
  Ciclev10006694m 31 DYEANSRIRDPVYGCAGTVCHLQKQVSELQADQQ 64
                     5****************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031959.1E-93064IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MGESGDRRLS HQTTCDRRLS HQALDCKLIM DYEANSRIRD PVYGCAGTVC HLQKQVSELQ  60
ADQQQNLIAL ICMEMAQSQE QVLHRHQQQQ PQQLFIDTSC FLDEYSLGST WEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024952279.13e-47LOB domain-containing protein 1-like
TrEMBLV4S6A91e-80V4S6A9_9ROSI; Uncharacterized protein
STRINGXP_006421125.12e-81(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-13LOB domain-containing protein 11