PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10006413m
Common NameCICLE_v10006413mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bHLH
Protein Properties Length: 140aa    MW: 16037.3 Da    PI: 7.4136
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10006413mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH469.2e-1566117255
                      HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
              HLH   2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                      +  hn+ Er RR++iNs ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  Ciclev10006413m  66 KLYHNASERDRRKKINSLYSSLRSLLPVA--DQTKKLSIPATVSRVLKYIPELQ 117
                      667*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.80264116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.43E-565121No hitNo description
SuperFamilySSF474591.03E-1665134IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.6E-1266117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.4E-1466134IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003538.7E-1170122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MCALFPPFFP SLGWPLEINP ICHQQDYITE TIEESPQFPQ ESEPQAEFDR SASFSANSGD  60
PTMVKKLYHN ASERDRRKKI NSLYSSLRSL LPVADQTKKL SIPATVSRVL KYIPELQQQV  120
ERLMQKKEEL LSKISKPGEI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006421111.11e-99hypothetical protein CICLE_v10006413mg, partial
SwissprotQ9M1K11e-40ORG2_ARATH; Transcription factor ORG2
TrEMBLA0A067DMC37e-99A0A067DMC3_CITSI; Uncharacterized protein
TrEMBLV4SBL61e-99V4SBL6_9R
STRINGVIT_13s0047g00450.t014e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48228153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.11e-38bHLH family protein