PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10006208m
Common NameCICLE_v10006208mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 130aa    MW: 14197.1 Da    PI: 7.8869
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10006208mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.41.4e-44121111100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+ rr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++l+e++r++a+ss+vyeA+ar +dPv+G+vg i++lqqq+e+l+a+l
  Ciclev10006208m  12 PCAACKLIRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELQEHQRSEAVSSMVYEANARFHDPVRGCVGAISSLQQQVESLQAQL 105
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  Ciclev10006208m 106 ALAQAE 111
                      **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.711112IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4312109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MESGTRQGAL SPCAACKLIR RRCAQDCVFA PYFPADEPQK FASVHKVFGA SNVNKMLQEL  60
QEHQRSEAVS SMVYEANARF HDPVRGCVGA ISSLQQQVES LQAQLALAQA EVEQMRMRLI  120
SPSSSSSHN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4751124111LOB family transfactor Ramosa2.1
5ly0_B2e-4751124111LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422220.17e-91LOB domain-containing protein 4
RefseqXP_006475321.17e-91LOB domain-containing protein 4 isoform X1
SwissprotQ9SHE91e-57LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A067F2R82e-89A0A067F2R8_CITSI; Uncharacterized protein
TrEMBLV4S9E02e-89V4S9E0_9ROSI; Uncharacterized protein
STRINGXP_006475321.13e-90(Citrus sinensis)
STRINGXP_006422220.13e-90(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-52LOB domain-containing protein 4