PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10004441m
Common NameCICLE_v10004441mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 717aa    MW: 78864.8 Da    PI: 6.7372
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10004441mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.9e-16420458240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  Ciclev10004441m 420 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 458
                      689**********************************96 PP

2TCR50.93.1e-16505544140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Ciclev10004441m 505 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNTF 544
                      589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-18419460IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.451420545IPR005172CRC domain
PfamPF036389.7E-12422457IPR005172CRC domain
SMARTSM011148.7E-18505546IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.7E-12507543IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MDTPKKATQM ATPLSKFEDS PVFNYINSLS PIKPVKSLPV TQTFNSLNFS SPPSIFTSPH  60
ISAHKETRFL RRNNCLGLSK PEFSSENGNK ICRNDGVAND ASQLYDNSAE LQENFDPRVS  120
MEEVSVEASN DSKFAIELPQ ALKYDCGSPG CDSNPCNIES NCMTEMASTS VSVVQFVQEA  180
SENGASEADV RLQRTCQMEQ KNEVTGCEWE SLISDAADLL IFNLPNDSED FKGLMQKSLD  240
SGGRYASVTP RYINGEPIME MIDPPISNLH RGMLRRCLDF ELVTRRKNAD GSSNYGSSVI  300
LHSDEKFASE DKQLVPLKPG SDSPRCMVPG IGLHLNALAI TPQENKNIGI ESLSSVRQIN  360
PHHEPLTSAS TERDIVAVEN GVLLAEDASQ TSAYLAEEEY NQNSPKKKRR RMENAGENES  420
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CQDCFNKPIH EDTVLATRKQ IESRNPLAFA  480
PKVIRSSDPL PEVGEDTSKT PASARHKRGC NCKKSSCLKK YCECYQGGVG CSINCRCEGC  540
KNTFGRKDGS SSTDPEAEPE DEEMEMCEKS GVDKRFQKTE FLSNEEQNPG SALPTTPLRL  600
SRPLVQLPFS TKCKPPRSLL SIGSSSGFFT GHNYGKPNIL RSQPKFEKSL QTAPEDEMPE  660
ILRGNCTPCS GIKTSSPNSK RVSPPHTILG SSPSRRSGRK LILQSIPSFP SLTPKH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405410KKKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006420002.10.0hypothetical protein CICLE_v10004441mg
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLV4RZD10.0V4RZD1_9R
STRINGPOPTR_0010s09350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-152TESMIN/TSO1-like CXC 2