PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002739m
Common NameCICLE_v10002739mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SRS
Protein Properties Length: 162aa    MW: 17699.9 Da    PI: 9.8829
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002739mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70282.21.3e-25361765
           DUF702  7 sCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaa 65
                     +C+dCGn+ak++C+++RCRtCCk+r fdC+thv+stWvpaakrr++++  +  ss++ +
  Ciclev10002739m  3 ACRDCGNRAKRECSFRRCRTCCKTRRFDCTTHVRSTWVPAAKRRQKKKLITGGSSSSLS 61
                     7********************************************99888776665544 PP

2DUF70270.45.7e-225912986154
           DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgee...elaYqtavsigGhvfkGiLydqGlee 154
                      + s + ++a+ + e+ ++slP +v+++avfrc++v++v+dg++   e++Y ++v+i+GhvfkG+Lyd G++e
  Ciclev10002739m  59 SLSFS-TTASCQDESFKKSLPGKVQAPAVFRCIKVTAVSDGDDnkaEVGYVATVNISGHVFKGFLYDLGIDE 129
                      22222.2333444555677*******************88654222799********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.3E-403128IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.6E-23445IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016248.2E-2477127IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MRACRDCGNR AKRECSFRRC RTCCKTRRFD CTTHVRSTWV PAAKRRQKKK LITGGSSSSL  60
SFSTTASCQD ESFKKSLPGK VQAPAVFRCI KVTAVSDGDD NKAEVGYVAT VNISGHVFKG  120
FLYDLGIDEK KLFPWDSSGR ENKESSPPNV DSSNADATSG N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432446.11e-116hypothetical protein CICLE_v10002739mg
RefseqXP_006432447.11e-116hypothetical protein CICLE_v10002739mg
SwissprotQ9M2U42e-47SRS6_ARATH; Protein SHI RELATED SEQUENCE 6
TrEMBLA0A067EUM31e-115A0A067EUM3_CITSI; Uncharacterized protein
TrEMBLV4T8281e-116V4T828_9R
STRINGPOPTR_0001s06500.16e-55(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54430.11e-32SHI-related sequence 6