PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002348m
Common NameCICLE_v10002348mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 235aa    MW: 25388 Da    PI: 9.6812
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002348mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.53.4e-41461451100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll+++p+++r da++slv+eA+ r+rdPvyG++g i++lqqq+++l+ael
  Ciclev10002348m  46 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLSEVPDSQRADAANSLVFEANLRLRDPVYGCLGAISSLQQQVQSLQAEL 139
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  Ciclev10002348m 140 NAMRTE 145
                      *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.48245146IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4146143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MSRDRERFDE IGKRIKRESD VLNSQMGRRQ MLNPNSSAGT LNTVTPCAAC KLLRRRCAEE  60
CPFSPYFSPH EPQKFAAVHK VFGASNVSKL LSEVPDSQRA DAANSLVFEA NLRLRDPVYG  120
CLGAISSLQQ QVQSLQAELN AMRTEIMKYK YREAATASTI ISSSNPLFSS GVVSIVGGSS  180
APSLSTSQPP PHPPPPPPPS IVISSSSSSS VSSLYTPPMR TTDYVKALLV VMLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-464616111126LOB family transfactor Ramosa2.1
5ly0_B8e-464616111126LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754454e-51HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755184e-51HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431987.11e-170LOB domain-containing protein 15 isoform X2
RefseqXP_006468163.11e-170LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T57e-78LBD15_ARATH; LOB domain-containing protein 15
TrEMBLV4SWR61e-169V4SWR6_9ROSI; Uncharacterized protein
STRINGXP_006468163.11e-170(Citrus sinensis)
STRINGXP_006431987.11e-170(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-76LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]