PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002081m
Common NameCICLE_v10002081mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YC
Protein Properties Length: 287aa    MW: 31857.1 Da    PI: 5.4626
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002081mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.22.2e-196861898
            NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                     ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t+    ++ +v++ ++fdfl div r
  Ciclev10002081m  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYEITLQRGAKTMSSLHLKHCVQSYNVFDFLRDIVSR 86
                     5789**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.6E-26372IPR009072Histone-fold
SuperFamilySSF471131.35E-20489IPR009072Histone-fold
PfamPF008084.8E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YEITLQRGAK  60
TMSSLHLKHC VQSYNVFDFL RDIVSRVPDY SHGHSDATSE DRSISKRRKA AGDECNDSDE  120
ESKRSRMHEM GHVTGSGRGR GRGRGRGRGR GARHLERESS HREVEPEPRT APQHGASDNS  180
NSTMLVDNAS ESKEQPKENV IASDGVNPAT RNFDLNADLD ENVDTKTAAP AAPTQPSSAG  240
PSEETKHEEY PGWSLSEMDR MAIDPLQIAN LSRRIDEEEE DYDEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139149RGRGRGRGRGR
2141150RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432367.10.0dr1-associated corepressor isoform X1
TrEMBLV4SXS00.0V4SXS0_9ROSI; Uncharacterized protein
STRINGXP_006432367.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.15e-82nuclear factor Y, subunit C11