PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002004m
Common NameCICLE_v10002005mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 299aa    MW: 33481.5 Da    PI: 4.4866
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002004mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.51.6e-09137178445
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                      +k+ rr  +NR AA rsR+RKk++++ Le k+  Le+e ++L
  Ciclev10002004m 137 SKKRRRQLRNRDAAVRSRERKKMYVKDLEIKSRYLESECRKL 178
                      6999**********************************8877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-11132196No hitNo description
SMARTSM003381.2E-7133198IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.921136193IPR004827Basic-leucine zipper domain
PfamPF001701.5E-8138180IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-10138194No hitNo description
CDDcd147041.57E-14139190No hitNo description
PROSITE patternPS000360141156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MADDEFLEDE FDWNNLLTEL TDPSTAEIFS NPSPDGSVSP WIGDIESMLM NDNDDNSELE  60
PNQQSLDDFF ADVFVDQPSP ASGAEVIELP TDKDQNGADE SGNASPAEEK VLDEPEVNNS  120
DKNYNDTDND NADDPISKKR RRQLRNRDAA VRSRERKKMY VKDLEIKSRY LESECRKLGR  180
LLHCVLAENQ SLRFSLQKGN AYGASLTKQE SAVLLLESLL LGSLLWFLGI MCLFTLPKPI  240
WSHLESVPLV QVEEKAPGNL VQREAGSKNY LLAVVKSRRC KASRRKMKMT SHALSVLA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138157KRRRQLRNRDAAVRSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435475.10.0bZIP transcription factor 60
TrEMBLV4TB170.0V4TB17_9ROSI; Uncharacterized protein
STRINGXP_006435475.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.17e-38basic region/leucine zipper motif 60