PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001824m
Common NameCICLE_v10001824mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SRS
Protein Properties Length: 328aa    MW: 36339.8 Da    PI: 7.1525
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001824mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702227.62.3e-701072603154
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel..kskkqsalsstklssa 94 
                       g+++CqdCGnqakkdC h+RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa++++++++++++ ++++ ++  ++++q++    + +++
  Ciclev10001824m 107 GGGMNCQDCGNQAKKDCPHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQRHQQQQEQQQLNQQDSQHhhHHHQQQQFRGENPKRQ 200
                      5789*****************************************************9999888754444433333114455555666666677 PP

           DUF702  95 eskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       +++ le+s++P+e+ss+avfrcvrvs++dd +ee+aYqtav+igGhvfkGiLydqG+e+
  Ciclev10001824m 201 RENQGLEVSQFPSELSSSAVFRCVRVSAIDDPDEEFAYQTAVHIGGHVFKGILYDQGPEN 260
                      788999****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.9E-66109259IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.9E-27111153IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-26210258IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAGWFYLGGR EEARSKQEEE EEKEENLYLY RSSANEEIYN STKGFELWPQ YYHQQQENMS  60
NYLSFGVGPS RRSSSNFINA AAASDESSRS GGFVMRQGVG GGGGGGGGGM NCQDCGNQAK  120
KDCPHMRCRT CCKSRGFQCQ THVKSTWVPA AKRRERQQQL AALQRHQQQQ EQQQLNQQDS  180
QHHHHHHQQQ QFRGENPKRQ RENQGLEVSQ FPSELSSSAV FRCVRVSAID DPDEEFAYQT  240
AVHIGGHVFK GILYDQGPEN RYTAAAESSH SQQLNLITAA TATTTTTTGT VAAGTSNPSA  300
NLIDPSLYPA PLNAFIAGTQ FFPPPRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1837772e-35AC183777.9 Medicago truncatula clone mth2-67d13, complete sequence.
GenBankAC1600132e-35AC160013.22 Medicago truncatula clone mth2-162b23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435091.10.0hypothetical protein CICLE_v10001824mg
SwissprotQ9LQZ51e-92SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLV4TF820.0V4TF82_9R
STRINGPOPTR_0002s03000.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-72SHI-related sequence 5