PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001776m
Common NameCICLE_v10001400mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family BBR-BPC
Protein Properties Length: 336aa    MW: 37281.1 Da    PI: 9.9379
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001776mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind389.45.5e-11913351301
        GAGA_bind   1 mdddgsre..rnkg.yyepa..aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllv 87 
                      mdd g+re  r+k+ +y+ a  + l +++   +q+m+++aerda+++ernla+sekkaa+aerdmaflqrd+a+aern+a++erdn++++l+++
  Ciclev10001776m   1 MDDGGHREngRHKAdQYKAAqgQWLMHHQpsMKQIMTIMAERDAALQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIASLQYR 94 
                      9*****999*****99*9544433433331145************************************************************* PP

        GAGA_bind  88 ensla...salpvgvqvlsgtksidslqqlse..pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                      ensl    s++p+g+q+++g+k++++ qq+ +  +++++ a+  re+++ +alp++  a+ea + ++ k   r   +ke+k  +++kk++ks +
  Ciclev10001776m  95 ENSLGgnmSSCPPGCQISRGVKHMHHPQQHVHqlHHVSEAAYS-REMHTGDALPVSPGASEAAKPRRYK---R---AKEPKVLSPNKKTAKSPR 181
                      **9878889********************55545555565555.**********988666665555554...4...444444455555556667 PP

        GAGA_bind 177 kvkkesader.............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSv 241
                      kvk+e++d +                             sk+++k + l+ln+v++Dest+P+P+CsCtG+lrqCYkWGnGGWqSaCCtt++S+
  Ciclev10001776m 182 KVKRENEDLNkvvfgkpsewksvqdldggdddvnkqstaSKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSM 275
                      777777664447788889999************************************************************************* PP

        GAGA_bind 242 yPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      yPLP+++++r+aR++grKmS++af+klL +LaaeG+dls+pvDLkdhWAkHGtn+++ti+
  Ciclev10001776m 276 YPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK 335
                      ***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012266.0E-1701335IPR010409GAGA-binding transcriptional activator
PfamPF062171.6E-1021335IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDDGGHRENG RHKADQYKAA QGQWLMHHQP SMKQIMTIMA ERDAALQERN LAISEKKAAI  60
AERDMAFLQR DTAIAERNNA ILERDNAIAS LQYRENSLGG NMSSCPPGCQ ISRGVKHMHH  120
PQQHVHQLHH VSEAAYSREM HTGDALPVSP GASEAAKPRR YKRAKEPKVL SPNKKTAKSP  180
RKVKRENEDL NKVVFGKPSE WKSVQDLDGG DDDVNKQSTA SKSDWKGQVL GLNQVTFDES  240
TMPPPACSCT GVLRQCYKWG NGGWQSACCT TSLSMYPLPA VPNKRHARVG GRKMSGSAFN  300
KLLTRLAAEG HDLSHPVDLK DHWAKHGTNR YITIK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.9550.0vegetative tissue
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal vasculature, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435128.10.0protein BASIC PENTACYSTEINE6
RefseqXP_024038773.10.0protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-162BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLV4TA250.0V4TA25_9R
TrEMBLV4TFC00.0V4TFC0_9R
STRINGGLYMA04G02860.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-161basic pentacysteine 6
Publications ? help Back to Top
  1. Asamizu E, et al.
    Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
    DNA Res., 1998. 5(6): p. 379-91
    [PMID:10048488]