PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001376m
Common NameCICLE_v10001376mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family CPP
Protein Properties Length: 400aa    MW: 43674.6 Da    PI: 7.5755
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001376mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.77.4e-16231268340
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+CnCk+skClk+YCeCfaag +C e C+C dC+Nk 
  Ciclev10001376m 231 CKRCNCKRSKCLKLYCECFAAGLYCIEPCSCLDCFNKP 268
                      89**********************************96 PP

2TCR52.59.9e-17315354140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++kkgCnCk+s+ClkkYCeCf+ g+ Cs +C+Ce+CkN+ 
  Ciclev10001376m 315 RHKKGCNCKRSSCLKKYCECFQGGVGCSISCRCEGCKNSF 354
                      589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.0E-18229270IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.435230355IPR005172CRC domain
PfamPF036382.0E-11232267IPR005172CRC domain
SMARTSM011141.5E-17315356IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.8E-12317353IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MVTGSRSCSC KQSEMTEPLT QPEEIENLKD TDRTPDILSS TLLDKLIVSD SREKMDNEEE  60
KCGQSSCKHN ILRRCLDFEM VGARKKKVAC ESNCTSSNLS QADCKDASIK KHFVPSKSKS  120
SSSSMVAGAG LHLNALAAAS KDGKLVKCKT TASGSKVISM RICESPCLSL TSCPNLLNKS  180
EERDPVPCGT EVYVVENAMQ PSVSVGSEEF NHSSPKRKRY KPEHNVESMA CKRCNCKRSK  240
CLKLYCECFA AGLYCIEPCS CLDCFNKPIH EDKVLETRRQ IELRNPLAFA PKVIRSTDST  300
VELGDEANKT PASARHKKGC NCKRSSCLKK YCECFQGGVG CSISCRCEGC KNSFGRKDVP  360
NFAVFSPLGA EEGEYDGEES ETCAKSESDA NIHDNTEGG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214221PKRKRYKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432991.10.0hypothetical protein CICLE_v10001376mg
RefseqXP_006471928.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X3
SwissprotF4JIF51e-89TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A067DFH00.0A0A067DFH0_CITSI; Uncharacterized protein
TrEMBLV4T9J70.0V4T9J7_9R
STRINGVIT_14s0030g01800.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-83TESMIN/TSO1-like CXC 2