PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10001292m
Common NameCICLE_v10001292mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 420aa    MW: 46634.5 Da    PI: 9.4662
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10001292mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32248301255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Ciclev10001292m 248 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 301
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15245301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28246301IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-23248301IPR006447Myb domain, plants
PfamPF002492.9E-7249300IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWSSRRG AAAEEEMDLG FWKRALDSRN SSSMAAANAK  60
PSSDISTGGG FELSLSNPAR VSSSSVLSES LSSNNNLNHH HQFHLLQNNT TTTTNCNGNN  120
IFHSFHHQQN HSQFPTHHHL HQNQHHHPVL YHQPPQQQGL SQELGFLRPI RGIPVYQNPH  180
HHHHHHQASH AFPFPHHQQQ PLDSPPPPSL VANNNTSTSS LNSFQSQQGL MRSRFMSRFP  240
AKRSMRAPRM RWTTTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR  300
TVKTTDRAAA SSGQSDAFEN GSSGDTSEDI MFGIQHPRRP ETSSIQQQGR ASNGLWSNSS  360
SREAWLHGKT KDSAINLPSL EEVDPKCMSY EGISDVSSPN ISATSPKKPN LEFTLGRPH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006471518.10.0PREDICTED: probable transcription factor KAN2 isoform X1
RefseqXP_006432742.10.0hypothetical protein CICLE_v10001292mg
SwissprotQ9C6161e-103KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A067E5600.0A0A067E560_CITSI; Uncharacterized protein
TrEMBLV4SYT40.0V4SYT4_9R
STRINGPOPTR_0001s02010.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-78G2-like family protein