PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_47212
Common NameKK1_046156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 175aa    MW: 19609.2 Da    PI: 6.7646
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_47212genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601421.9e-4461051100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+C+k+C++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+
  C.cajan_47212   6 PCASCKLLRRRCSKECIFAPYFPSDDPRKFAIVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQSQVSQLQMQLAV 101
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  C.cajan_47212 102 AQAE 105
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7485106IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCSKE CIFAPYFPSD DPRKFAIVHK VFGASNISKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQS QVSQLQMQLA VAQAEILCIQ MQQQDPTLGA  120
TQVVDQEDHK SLLLCENNNN YEILPHYLSF PSSSSSSSNV FQDHHEPLKR ESFWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-106AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551217.11e-107PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW39e-76LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A151QRV11e-130A0A151QRV1_CAJCA; LOB domain-containing protein 12
STRINGGLYMA18G06530.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-63LBD family protein