PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_45207
Common NameKK1_047616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GRF
Protein Properties Length: 533aa    MW: 57228.7 Da    PI: 7.959
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_45207genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.16.5e-23148189142
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                    d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr r+ +s
  C.cajan_45207 148 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRRPRS 189
                    79************************************9887 PP

2QLQ50.94.6e-1892125235
            QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                    +FT aQ+ +L++Q+++yKy++a++PvPp Ll  i
  C.cajan_45207  92 PFTTAQWRELERQAMIYKYMMASVPVPPGLLNLI 125
                    8***************************999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.1E-1091127IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.4292127IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.6E-1392125IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.98148195IPR014977WRC domain
PfamPF088794.6E-18149189IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MTMMAHHNHH HRPLSSSPFD NVPCAAADAD ADADGPTAYM SFTNHINLVS ALAPPAPAPA  60
TPLQPFDISP YTSPTTTFKP SAGGMAASLG FPFTTAQWRE LERQAMIYKY MMASVPVPPG  120
LLNLIPTSTS RSPCMDGAFN LRLASSSDPE PGRCRRTDGK KWRCSRDVAP NHKYCERHMH  180
RGRPRRPRSR KPVEVHTNTP TPTSINNNNN NEQIKRARHE SIPSPTPDVA VAVSNPTSRK  240
DGSSPHFLAS STTTQPYLES SLSLANFGVK SANFDSVAPL SSNNKEPRGL DWMLNGDPIS  300
LGASDSEWQS LIHNKVGMTS ESSCNTTEPQ YLNSFALYSS GMDQHNRRHP LFLNPLVVPM  360
ENLQQEKPRG FIDAWSNSET GEGNANINKN SAASIGKLSL SSLDLSMGGG AVHEDIGTIE  420
MGLGNKHTDT KSSLSNWLNP APWVASTPGG PLAEVLRSST VTATNEAAST TSSQATTHVE  480
SNSPLGTMVS SPSGVLQKTL ASLSDSSSNS SPRVASSRAN SEMALLRFQS SVN
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_45207
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029126230.10.0LOW QUALITY PROTEIN: growth-regulating factor 2
TrEMBLA0A151UIM60.0A0A151UIM6_CAJCA; Uncharacterized protein
STRINGXP_007136458.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.18e-28growth-regulating factor 7