PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_45197
Common NameKK1_042423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family ARR-B
Protein Properties Length: 627aa    MW: 69240.8 Da    PI: 6.6271
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_45197genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.83.3e-25198249153
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                    kpr++W+ eLH++Fv+av+qL G+ekA+Pk+il+lm+v+ Lt+e+v+SHLQ +
  C.cajan_45197 198 KPRVVWSVELHRKFVSAVNQL-GIEKAVPKKILDLMNVEKLTRENVASHLQAF 249
                    79*******************.*****************************87 PP

2Response_reg78.72e-26141201107
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ +++l+++l+k +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +g+++++ + +  Ga
  C.cajan_45197  14 VLAVDDDPTCLKVLETLLRKCQY-HVTSTKNAITALKLLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGDPKMVMKGITHGA 107
                    799********************.***************888888*******************87754.558*********************** PP

                    SEEEESS--HHHH CS
   Response_reg  95 kdflsKpfdpeel 107
                     d+l Kp+ +eel
  C.cajan_45197 108 CDYLLKPVRIEEL 120
                    ***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.4E-1601623IPR017053Response regulator B-type, plant
SuperFamilySSF521722.7E-3511136IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.6E-4211146No hitNo description
SMARTSM004481.4E-3112124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.64713128IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.8E-2414121IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.30E-2615128No hitNo description
PROSITE profilePS512949.909195254IPR017930Myb domain
SuperFamilySSF466898.24E-16195249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-25196249IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-22198249IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MDDLRDQFPI GMRVLAVDDD PTCLKVLETL LRKCQYHVTS TKNAITALKL LRENKNKFDL  60
VISDVHMPDM DGFKLLELVG LEMDLPVIML SVNGDPKMVM KGITHGACDY LLKPVRIEEL  120
QIIWQHVIRR KKTDPKEQNK TSNQEKPDAD CCNGRESAAT GNSDQSGKSS KRRKDEDEDE  180
HEDHENSHDN EDPSTQKKPR VVWSVELHRK FVSAVNQLGI EKAVPKKILD LMNVEKLTRE  240
NVASHLQAFS HPFFFSLMLY LKRISRVANQ QANMVAALGT ADSSYSRMGS LSGLRPLQTF  300
SGPQQFHNNA FRPFPPGGMT GRFSTSVGLN VHGLPSSENL KLGHAQNLNN SMNDPLKFQS  360
SQIGGNHNGI QGMPTFLGLD QLQHNKGVSV GPVQNLSPII DAKSTFPMPN NALTKDTQGS  420
GAYQNLTQLA SQNSQFSIPL MDQGRCSDIW ASPVQSPGTN SYPPSDVNLS GASSITSMSN  480
QSHDSLTDMP SQGVFLTNNS GLMSNNVPLQ GWDNHNHDTS YHSNAIGNTI DSLISVNPVD  540
TEGHTTVNST FNRDLGFNFC DQFQMKPDGV MGLSGETSLK AHQGYIMNQQ KSQNSCATNI  600
NVGSLEYFVN SMMTQVIKFI QFDAVSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-23194249156ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_45197
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2362211e-129AC236221.2 Glycine max clone GM_WBc0105L07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020205567.10.0two-component response regulator ARR12
SwissprotQ6K8X61e-134ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A151R1P60.0A0A151R1P6_CAJCA; Two-component response regulator
STRINGGLYMA17G33230.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]