PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43418
Common NameKK1_046139
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family GeBP
Protein Properties Length: 167aa    MW: 19018.9 Da    PI: 10.0774
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43418genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57377.81.7e-241791997
         DUF573 19 lidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                   + +f ++tg +p+++ d f++ +k+ +++ +s +ql eKirrLKkKf+ ++++ k+g++p+fsk+hd+ +f+lsk++W 
  C.cajan_43418  1 MAEFISSTGNDPYKHADSFHDSIKNMLHVAASINQLKEKIRRLKKKFEANSRRGKNGDDPHFSKPHDSTMFHLSKMVWA 79
                   678999************************************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.9E-21178IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MAEFISSTGN DPYKHADSFH DSIKNMLHVA ASINQLKEKI RRLKKKFEAN SRRGKNGDDP  60
HFSKPHDSTM FHLSKMVWAV KPRPSEKQLV TVKSLMGNDL DSLYLEIAGM KELGEDEMKK  120
GLALIGESKR KELEGRWSQL RLAQLQLVSD RSQLTGEIVK LIHEALH
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_43418
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020207948.11e-121probable transcription factor At1g61730
TrEMBLA0A151QRX21e-119A0A151QRX2_CAJCA; Uncharacterized protein
STRINGGLYMA05G12406.11e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.13e-14DNA-binding storekeeper protein-related transcriptional regulator