PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43373
Common NameKK1_044200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Trihelix
Protein Properties Length: 314aa    MW: 37582.8 Da    PI: 8.1578
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43373genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix68.11.7e-2138100163
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykk 63 
                    +W+ qe+++ + +r e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk 
  C.cajan_43373  38 QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTRYKM 100
                    7************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.21E-2237100No hitNo description
PfamPF138376.1E-1738102No hitNo description
PROSITE profilePS500907.3643995IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEGHHLHHHH RQQIQQHHHH PHNITTSVNV DVTDRFPQWS IQETKEFLVI RAELDQTFME  60
TKRNKQLWEV ISNRMKEKGY HRSAEQCKCK WKNLVTRYKM YNILITSTQL IKLFIFITYI  120
SLYNLKGCET MEPEAMRQQF PFYNELQAIF TARMQRMLWA EAEGGSNKKK GVQHLSSEEE  180
EEGNEESEGD IHHKGGGMSR KKKKGKMVVG GGSGGGVANN SNLESLKEIM EEFMRQQMQM  240
EAQWMEAFEA RENERRLKEM EWRQTMEALE NERMMMDQRW REREEQRRIR EEVRADKRDA  300
LITALLNKLR REEM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140273.11e-134hypothetical protein PHAVU_008G098300g
SwissprotQ9SDW01e-66TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A151QX600.0A0A151QX60_CAJCA; Zinc finger and SCAN domain-containing protein 20
STRINGGLYMA18G43190.21e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.19e-50Trihelix family protein