PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43330
Common NameKK1_045618
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family WOX
Protein Properties Length: 320aa    MW: 35635.8 Da    PI: 7.2693
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43330genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-083402457
                   S--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox 24 ypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  C.cajan_43330  3 NPPRDEIRRIRVQLqeygQVGDANVFYWFQNRKSRSKH 40
                   7999*******************************995 PP

2Wus_type_Homeobox673.4e-221412464
  Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +++P+++ei+ri+ +L+eyG+++d+NVfyWFQNrk+R+++k
      C.cajan_43330  1 MVNPPRDEIRRIRVQLQEYGQVGDANVFYWFQNRKSRSKHK 41
                       78*************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000463.0E-6340IPR001356Homeobox domain
SuperFamilySSF466891.2E-5344IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVNPPRDEIR RIRVQLQEYG QVGDANVFYW FQNRKSRSKH KLRHLQNSKN KNAEAHQNAV  60
SLPQMTPPSS SSSSSEKSSP KKFMHPKGFS FGFSNVNDAV PNSPTTSVNQ TYFQPYHHNE  120
TNLLPPAPES FSFLAHNNGQ CVATDAMSTL GFSFPDFSNN MMQSQHVGPC TSLLLNEITN  180
HETSSKKDLD EEKALKIMHQ HPQHNFSLTT TPLTTVVHPS TSTPISAPCP INQFQGVGDG  240
AADRAQCTVF FNDVAFEVAV GPFNVRQAFG DEAMLFYSSG HPVPTNEWGV TLHPLQHGAY  300
YYLGLVCIFF SYSINFFLSG
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_43330
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029126019.10.0WUSCHEL-related homeobox 9
RefseqXP_029126020.10.0WUSCHEL-related homeobox 9
TrEMBLA0A151QTC70.0A0A151QTC7_CAJCA; WUSCHEL-related homeobox 9
STRINGXP_007153888.11e-132(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.17e-36WUSCHEL related homeobox 8