PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_43251
Common NameKK1_046324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 278aa    MW: 31633.4 Da    PI: 5.7461
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_43251genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-1875128356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  C.cajan_43251  75 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 128
                    456899***********************************************9 PP

2HD-ZIP_I/II1314.6e-4274164191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+y+++k++n++L++++++L++e+
  C.cajan_43251  74 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYETIKADNDALQAQNQKLQTEI 164
                    69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-1968132IPR009057Homeodomain-like
PROSITE profilePS5007117.39470130IPR001356Homeobox domain
SMARTSM003891.8E-1873134IPR001356Homeobox domain
CDDcd000869.97E-1675131No hitNo description
PfamPF000461.5E-1575128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-1977137IPR009057Homeodomain-like
PRINTSPR000311.1E-5101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5110126IPR000047Helix-turn-helix motif
PfamPF021832.3E-15130170IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MAFFPANFML QTPHQDDHQP PPSLNSIITS CAPQEYHGGA SFLGKRSMSF SGIELGEEAN  60
AEEDLSDDGS QAGEKKRRLN MEQVKTLEKS FELGNKLEPE RKMQLARALG LQPRQIAIWF  120
QNRRARWKTK QLEKDYDLLK RQYETIKADN DALQAQNQKL QTEILALKSR EPTESINLNK  180
ETEGSSSNRS ENSSEIKLDI SRTPAIDSPL STQQNSRTLF PPSARPTGVA QLFQTTPRPE  240
IQCQKIDHMV KEESLSNMFC GIDDQSGLWP WLEQQHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122130RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_43251
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0943750.0BT094375.1 Soybean clone JCVI-FLGm-24F2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020208060.10.0homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-116ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A151QRE90.0A0A151QRE9_CAJCA; Homeobox-leucine zipper protein ATHB-13
STRINGGLYMA18G15970.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-107HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]