PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_40504
Common NameKK1_038254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family RAV
Protein Properties Length: 347aa    MW: 37705.6 Da    PI: 8.9811
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_40504genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP238.82.3e-1283131155
            AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                    s+ykGV     +grW A+I++      ++r++lg+f  ++eAa+a++ a+ +++g
  C.cajan_40504  83 SKYKGVV-PQLNGRWGAQIYEK-----HQRVWLGTFNEEDEAARAYDVAAVRFRG 131
                    79****6.7779*********3.....5**********99***********9998 PP

2B367.81.5e-211952613096
                    ..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3  30 keesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++++ l +ed  g++W+++++y+++s++yvltkGW++Fvk+++Lk+gD+v F+++   +++l++ +
  C.cajan_40504 195 AAKGVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDTVCFHRSTGPDKQLYIDW 261
                    4578899***********************************************8766777777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008473.0E-783131IPR001471AP2/ERF domain
CDDcd000184.65E-2583138No hitNo description
SuperFamilySSF541711.31E-1683139IPR016177DNA-binding domain
PROSITE profilePS5103219.91584139IPR001471AP2/ERF domain
SMARTSM003802.4E-2784145IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.103.1E-2084139IPR001471AP2/ERF domain
SMARTSM010191.8E-7175265IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-23194264IPR015300DNA-binding pseudobarrel domain
PfamPF023628.7E-19195262IPR003340B3 DNA binding domain
SuperFamilySSF1019361.44E-18197259IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.364201265IPR003340B3 DNA binding domain
CDDcd100171.07E-16203250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009741Biological Processresponse to brassinosteroid
GO:0009910Biological Processnegative regulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MDAISCMDES TTTESLSMSL SPTMSSKKAF VSASPTTSSK KTYVSPPPLS GTLCRVGSGA  60
SAVVDSDSGG GGTEVESRKL PSSKYKGVVP QLNGRWGAQI YEKHQRVWLG TFNEEDEAAR  120
AYDVAAVRFR GKDAVTNFKG LAAAEDDDGE AEFLNSHSKS EIVDMLRKHT YNDELEQSKR  180
SRGVSVNGVN VSATAAKGVL LNFEDVGGKV WRFRYSYWNS SQSYVLTKGW SRFVKEKNLK  240
AGDTVCFHRS TGPDKQLYID WKARNVVVNV NVNVNVNKEV GLFGPVAEPV QMVRLFGVNI  300
LKLPGSECIA NSNNTSGAIP GCCGGKRREM ELFSLECSKK PKIIGAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-3519226445117DNA-binding protein RAV1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds specifically to bipartite recognition sequences composed of two unrelated motifs, 5'-CAACA-3' and 5'-CACCTG-3'. May function as negative regulator of plant growth and development. {ECO:0000269|PubMed:15040885, ECO:0000269|PubMed:9862967}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00139DAPTransfer from AT1G13260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_40504
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by brassinosteroid and zeatin. {ECO:0000269|PubMed:15040885}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150435e-82AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020202294.10.0AP2/ERF and B3 domain-containing transcription repressor TEM1
SwissprotQ9ZWM91e-108RAV1_ARATH; AP2/ERF and B3 domain-containing transcription factor RAV1
TrEMBLA0A151RDE00.0A0A151RDE0_CAJCA; AP2/ERF and B3 domain-containing transcription factor RAV1
STRINGGLYMA01G22260.11e-175(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29203274
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25730.13e-82ethylene response DNA binding factor 3
Publications ? help Back to Top
  1. Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S
    RAV genes: regulation of floral induction and beyond.
    Ann. Bot., 2014. 114(7): p. 1459-70
    [PMID:24812253]
  2. Mittal A,Jiang Y,Ritchie GL,Burke JJ,Rock CD
    AtRAV1 and AtRAV2 overexpression in cotton increases fiber length differentially under drought stress and delays flowering.
    Plant Sci., 2015. 241: p. 78-95
    [PMID:26706061]
  3. Huang Y,Feng CZ,Ye Q,Wu WH,Chen YF
    Arabidopsis WRKY6 Transcription Factor Acts as a Positive Regulator of Abscisic Acid Signaling during Seed Germination and Early Seedling Development.
    PLoS Genet., 2016. 12(2): p. e1005833
    [PMID:26829043]
  4. Zhao Y, et al.
    ABA receptor PYL9 promotes drought resistance and leaf senescence.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(7): p. 1949-54
    [PMID:26831097]