PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_39856
Common NameKK1_037451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 414aa    MW: 46064.8 Da    PI: 7.9016
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_39856genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32233286255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  C.cajan_39856 233 PRMRWTSSLHNRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 286
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-15230287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-29231287IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-24233286IPR006447Myb domain, plants
PfamPF002493.0E-7234285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MPQNPIPDLS LHISLPNSAP SSIFTQGDSD SLFDIWPQQG DDAEGLKSHS DGSIKGSPHT  60
DTQLSLANPT STTRSEAEST WRKRNFVRVL HGVSEAEKLR LINGISLYSN LPSLDNSTSL  120
TIPSIERINS TNKLSSLYAV PHPPYSSNSA PNYNNNGIIG GVAVEQISRF HEIALENLGP  180
QQFQYFGYPH HQQYQQHQFG NSNNIGASSD FSNGFVKSRM LPRQQSKRNM RAPRMRWTSS  240
LHNRFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKNT DKPAASSDGD  300
EDFISLTVPN NQNKNFFPNQ RGPPNASIDN DMGYTCSNLW VNSSSSRGAR IQANSRDLNE  360
LSPQGILSSQ HSGKLSEGSN YIQARSFKDQ KLECQNPSLE FTLGRSNWHN NEHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-17234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-17234288458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_39856
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020240418.10.0transcription repressor KAN1 isoform X1
TrEMBLA0A151RF880.0A0A151RF88_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA07G12070.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-51G2-like family protein