PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_39656
Common NameKK1_039583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 80aa    MW: 9128.6 Da    PI: 10.4607
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_39656genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.71.3e-322474151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
  C.cajan_39656 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 74
                   79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-421675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.1321676IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-311776IPR002100Transcription factor, MADS-box
CDDcd002651.32E-411776No hitNo description
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-341838IPR002100Transcription factor, MADS-box
PfamPF003198.4E-282572IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-343853IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-345374IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MAFPNPSMSV SPQRKMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
IVFSSRGRLY EYANNSHGFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-221676161Myocyte-specific enhancer factor 2B
1tqe_Q4e-221676161Myocyte-specific enhancer factor 2B
1tqe_R4e-221676161Myocyte-specific enhancer factor 2B
1tqe_S4e-221676161Myocyte-specific enhancer factor 2B
6c9l_A4e-221676161Myocyte-specific enhancer factor 2B
6c9l_B4e-221676161Myocyte-specific enhancer factor 2B
6c9l_C4e-221676161Myocyte-specific enhancer factor 2B
6c9l_D4e-221676161Myocyte-specific enhancer factor 2B
6c9l_E4e-221676161Myocyte-specific enhancer factor 2B
6c9l_F4e-221676161Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_39656
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-100AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147970.11e-49hypothetical protein PHAVU_006G169600g, partial
SwissprotQ408721e-41AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLA0A151R9317e-53A0A151R931_CAJCA; Floral homeotic protein AGAMOUS
STRINGXP_007147970.14e-49(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-41MIKC_MADS family protein