PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_38797
Common NameKK1_034168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family HD-ZIP
Protein Properties Length: 279aa    MW: 31905.7 Da    PI: 7.1432
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_38797genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1884136456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  C.cajan_38797  84 KKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 136
                    556899**********************************************9 PP

2HD-ZIP_I/II128.82.2e-4182174193
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                    ekk+rls eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEk+ye+Lk++++a+k++n++L++++++L++el++
  C.cajan_38797  82 EKKKRLSLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKEYEVLKKQFEAVKADNDSLKAQNQKLHAELQT 174
                    69***************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-1974140IPR009057Homeodomain-like
PROSITE profilePS5007117.15178138IPR001356Homeobox domain
SMARTSM003894.6E-1881142IPR001356Homeobox domain
CDDcd000867.13E-1683139No hitNo description
PfamPF000461.7E-1584136IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-1985145IPR009057Homeodomain-like
PRINTSPR000319.6E-6109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000319.6E-6118134IPR000047Helix-turn-helix motif
PfamPF021834.6E-15138177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MAFPPSHTFM FQTHEDHDHQ LHLRSTSTTS LNAFPSFPPH HFQGAGAGFM MKRSMSFSGI  60
ENKCDEVHGD DELSDDGSQL GEKKKRLSLE QVKALEKSFE LGNKLEPERK MQLAKALGLQ  120
PRQIAIWFQN RRARWKTKQL EKEYEVLKKQ FEAVKADNDS LKAQNQKLHA ELQTLKSRDC  180
CETGTTSLKK ETEGSWSNGS NNSSDINLDL SRTPVMNSPV SSQNGKNLLP TSLKPNSITQ  240
LLQCSSRSDL QDESFCNMFH NIDEQQNFWP WPDQQHQFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_38797
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0956290.0BT095629.1 Soybean clone JCVI-FLGm-19L17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020237796.10.0homeobox-leucine zipper protein HAT7 isoform X1
SwissprotQ004663e-84HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A151RPB10.0A0A151RPB1_CAJCA; Homeobox-leucine zipper protein HAT7
STRINGXP_007151217.11e-179(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-81homeobox 3