PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_38743
Common NameKK1_040842
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 407aa    MW: 45258.5 Da    PI: 7.4998
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_38743genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.5e-32196251156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  C.cajan_38743 196 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIREMMKVEGLTNDEVKSHLQKYRLH 251
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.406193253IPR017930Myb domain
SuperFamilySSF466899.56E-17193254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28194254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26196251IPR006447Myb domain, plants
PfamPF002492.9E-7198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MASHAELSMD YKPYSYSTLL QSFTDQTDQT YKLEEFLSRL EEERLKIDAF KRELPLCMQL  60
LTNAVEASRQ QLQAFRSGQG TRPVLEEFIP IKHHPNSQES THEKASNISD KANWMTSAQL  120
WSQASEGTKP QSTITSQTEG ADVGFSVSPK LALDNKHRNG GAFLPFSKER NVCQGLKVAS  180
EAQTTNTNTT GQTHRKARRC WSPDLHRRFV NALQMLGGSQ VATPKQIREM MKVEGLTNDE  240
VKSHLQKYRL HVRRPIPSLQ PGAATPQVVV VGGIWVPPEY AAVASAAHSG GPTFYSPHLT  300
PQAPPPHYCA ATPVSQEFYN TVSSLSLPPP SQDQTIHHHF HMFNTAPQTQ SSPESGVRSG  360
GDRSESIEDW KSESSSWKGE SREKKGLAVL RDQEGEESFG SEITLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-15196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-15196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-15196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-15196249154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_38743
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150355e-70AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020204385.10.0myb family transcription factor EFM
SwissprotQ9ZQ851e-118EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A151R5X30.0A0A151R5X3_CAJCA; Two-component response regulator ARR18
STRINGXP_007138330.10.0(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-105G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]