PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_38133
Common NameKK1_038353
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 235aa    MW: 26604.5 Da    PI: 10.3969
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_38133genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.91.1e-221765149
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   k+i+n++n +vtfskRrngi+KKA+EL +LC+++ avi+fs+ ++++ +
  C.cajan_38133 17 KKISNERNLHVTFSKRRNGIFKKASELATLCGVDLAVIVFSPGQRVFSF 65
                   68******************************************99988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.2E-32968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.642969IPR002100Transcription factor, MADS-box
CDDcd002656.47E-341077No hitNo description
SuperFamilySSF554554.97E-271089IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-181131IPR002100Transcription factor, MADS-box
PfamPF003191.6E-241865IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-183146IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-184667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MNVVVKKTKG RQKIEMKKIS NERNLHVTFS KRRNGIFKKA SELATLCGVD LAVIVFSPGQ  60
RVFSFGTPSV DSVIQRYTGQ APPPLLNLDL NEAHLTVDER ELHAHLGYLS NQITIEKKRD  120
EELNHLLKTA KNNFWWATPI ERMDKTQLEK FKTALLDLKT HINLKKQKLL NESTYISPHI  180
FAGGSSSSNV NNNATVLPQP LLRNLVIDGS ITSHQQFNKN LDGHEHGPGP TFRFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-171083275MEF2 CHIMERA
6byy_B7e-171083275MEF2 CHIMERA
6byy_C7e-171083275MEF2 CHIMERA
6byy_D7e-171083275MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_38133
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020202375.11e-175agamous-like MADS-box protein AGL62
TrEMBLA0A151RCQ71e-173A0A151RCQ7_CAJCA; Agamous-like MADS-box protein AGL62
STRINGGLYMA10G10295.16e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13864521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.18e-47AGAMOUS-like 62