PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36783
Common NameKK1_040686
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 84aa    MW: 9729.3 Da    PI: 10.7051
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36783genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.51.5e-322575151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
  C.cajan_36783 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 75
                   79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-421776IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-301777IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.9921777IPR002100Transcription factor, MADS-box
CDDcd002657.23E-401876No hitNo description
PRINTSPR004045.2E-341939IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PfamPF003199.6E-282673IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-343954IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-345475IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MAFPNQSMSS VSPQRKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LIVFSSRGRL YEYANNRYLL FFSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-221783170Myocyte-specific enhancer factor 2B
1tqe_Q5e-221783170Myocyte-specific enhancer factor 2B
1tqe_R5e-221783170Myocyte-specific enhancer factor 2B
1tqe_S5e-221783170Myocyte-specific enhancer factor 2B
6c9l_A5e-221783170Myocyte-specific enhancer factor 2B
6c9l_B5e-221783170Myocyte-specific enhancer factor 2B
6c9l_C5e-221783170Myocyte-specific enhancer factor 2B
6c9l_D5e-221783170Myocyte-specific enhancer factor 2B
6c9l_E5e-221783170Myocyte-specific enhancer factor 2B
6c9l_F5e-221783170Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_36783
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-107AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020204254.12e-49floral homeotic protein AGAMOUS
SwissprotQ408727e-42AG_PANGI; Floral homeotic protein AGAMOUS
SwissprotQ408858e-42AG_PETHY; Floral homeotic protein AGAMOUS
SwissprotQ435858e-42AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLA0A151R6337e-55A0A151R633_CAJCA; Floral homeotic protein AGAMOUS
STRINGGLYMA08G12730.23e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.27e-41MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  2. Cheung AY,Zhan XY,Wang H,Wu HM
    Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein.
    Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8
    [PMID:8632979]