PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36586
Common NameKK1_038639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 381aa    MW: 42126.6 Da    PI: 8.5126
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36586genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32191244255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  C.cajan_36586 191 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 244
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15188244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28189244IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-24191244IPR006447Myb domain, plants
PfamPF002496.6E-7192243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MTLEGIFIEP TSTTAPDLSL HISPPSISSS SLISNNTTNY EPQPSFPSRS TVSQAHTELS  60
LGRNFTSTPT PTPTQPHNPY YQNQTPFHHL HHNNTTSTAT TSEGLRPIKG IPVYHNRSFP  120
FMAMDHARDK DHHHHPHKMA ATATRFNGFS GDAFKSHPLH QYGVGTSEAS SGLMRSRFLP  180
KLPNKRSMRA PRMRWTSTLH ARFVHAVELL GGHERATPKS VLELMDVKDL TLAHVKSHLQ  240
MYRTVKTTDK PAASSGQSDG SGEDELSPIG STADRGSLRQ FPNHQGRPEW TAQQDMDYSS  300
TTTLWSNSSS CGESRLRTNS NDIDGLRSPI LQSQTISAGH QIQECDSSQL KNSMPGSNLE  360
CKNPSLEFTL GRPDWNGKEQ A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16192246357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16192246357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16192246357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16192246357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16192246458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_36586
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150369e-81AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020202565.10.0transcription repressor KAN1
TrEMBLA0A151RC230.0A0A151RC23_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA14G39260.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-61G2-like family protein