PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_36447
Common NameKK1_038669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 149aa    MW: 17417.4 Da    PI: 10.2945
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_36447genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.11.5e-151050242
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                   +i++++ r++t+ kR++gi+KK +EL +LC++ ++ ii ss
  C.cajan_36447 10 FISDNTARKTTYKKRKKGIIKKVSELTILCGIPACAIISSS 50
                   89************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-21182IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.245150IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-20160IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-7323IPR002100Transcription factor, MADS-box
PfamPF003193.6E-141050IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MTRKKVKLAF ISDNTARKTT YKKRKKGIIK KVSELTILCG IPACAIISSS FESKPEIWPD  60
PERAKQMIEK YLNEAVLDQN KNINQESFIM QRIDKARDRL KKLRQENCEK ETTLSLFQYM  120
QGKDLPDNVE ELKKLDKLIE KNKKGIEIK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFISDNTARKTTYKKRK
22125KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_36447
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020202584.11e-104agamous-like MADS-box protein AGL80
TrEMBLA0A151RBX81e-102A0A151RBX8_CAJCA; MADS-box transcription factor PHERES 2
STRINGGLYMA10G28320.16e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13237929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.17e-28M-type_MADS family protein