PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_35673
Common NameKK1_032525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family M-type_MADS
Protein Properties Length: 221aa    MW: 25123.5 Da    PI: 10.1033
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_35673genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.62.2e-20350249
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   +  n++n qvtfskRrng++KKA+EL +LC+++ avi+fs   +++ +
  C.cajan_35673  3 KMTNERNLQVTFSKRRNGVFKKASELATLCGVDLAVIVFSRGERVFSF 50
                   56799***********************************99998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.208154IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-22172IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-22153IPR002100Transcription factor, MADS-box
PfamPF003191.1E-22450IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-91631IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-93152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MKKMTNERNL QVTFSKRRNG VFKKASELAT LCGVDLAVIV FSRGERVFSF GTPNVDSVIQ  60
RYTGRVAPPL TSLAHLTVDE RELHAHLGYL SNQFAAEKKR EEELSRLLKT AENHFWWATP  120
IENMNKAQLE KFKIALLNLK TRIDEKKEKL LDESTYNSPH FFAGGGSSSN VNDTMNVCPQ  180
PFLRNHVIDG SVTRNRRFNN MFRDGHEQGH GHGPGPTFGF F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183196RNHVIDGSVTRNRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapC.cajan_35673
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029130724.11e-166agamous-like MADS-box protein AGL62 isoform X1
TrEMBLA0A151RTR51e-164A0A151RTR5_CAJCA; Agamous-like MADS-box protein AGL62
STRINGXP_007145776.11e-71(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-33AGAMOUS-like 62